KEGG   Saprolegnia parasitica: SPRG_19830Help
Entry
SPRG_19830        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
spar  Saprolegnia parasitica
Pathway
spar01040  Biosynthesis of unsaturated fatty acids
spar01100  Metabolic pathways
spar01212  Fatty acid metabolism
spar04146  Peroxisome
Module
spar_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SPRG_19830
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SPRG_19830
Enzymes [BR:spar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SPRG_19830
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     SPRG_19830
    4.2.1.119  enoyl-CoA hydratase 2
     SPRG_19830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR SCP2 Epimerase NAD_binding_10 NAAA-beta DUF1191
Motif
Other DBs
NCBI-GeneID: 24141106
NCBI-ProteinID: XP_012199078
UniProt: A0A067CM37
LinkDB All DBs
Position
Unknown
AA seq 415 aa AA seqDB search
MLAFDGQVALVTGAAGGLGSTWARFLHERGATCVLVDTDPRILQLPSAPSVRWTAVVANC
ADEREGRRVVDDIVSAHGRVDILLHAATQVHDAAFRKMTRDQWEAVLEHDLSSAFTMTRA
VWAAMRQQNYGRILLCTSASGLYGNFGQANYAASKSGVWGLTKALAIEGRKYGIAVNAIA
AVAGTSLTQSVMPTEIYSRLKPAYTTSMVAFLCHGSSSENGGIFETGGGWIGKVRLERSA
GLGFPLNATPETVAQNWSQVVSFAKATHPETTQDSFAPMLRNVNAPPDTVHTAFTKKIRA
IFDRVHNVLQSPEGHALVAPVLGSSLQWTVGDAVFVIRVSAESKTVLIGRPLTPVDLEIR
MTESDFVAFVSGSLRLERAISTKKMAFVGNMKLAMKLQPFVKVLAQAQAGLQSRL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccttcgacgggcaagtggcgctcgtgaccggcgccgccggcggcctcggctcg
acgtgggcccgcttcttgcacgagcgcggcgcgacgtgcgtccttgtggacaccgacccg
cgcatcctccagctgccatcggcgccatcggtgcgctggaccgcggtcgtcgccaactgc
gccgacgagcgagagggccgccgtgtcgtggacgacattgtctccgcgcatggccgcgtt
gacatcctcttgcatgcggcgacgcaggtgcacgatgctgcgttccgcaagatgacgcgc
gaccagtgggaggcggtcctcgagcacgacctctcttcggcgttcaccatgacgcgcgcg
gtctgggcggccatgcggcagcaaaactatgggcgcatcctcctctgcacgagcgcgagt
ggcttgtacggcaactttggccaggccaactatgcggcctcgaagagcggggtgtggggg
ctcaccaaggcgcttgcgattgaaggccgcaagtacggcattgccgtcaacgccatcgcg
gccgtcgctggcacgtcgctgacgcagtcggtcatgccgaccgagatctactcgcgcttg
aagccggcgtacacgacatccatggtcgccttcctctgccatggctcgtcgtccgagaac
ggcggcatctttgagacgggcggcggctggatcggcaaggtgcgtctcgagcgcagcgcc
gggctcggcttcccgctcaacgcgacacccgagacagtggcgcaaaactggagccaggtc
gtgagctttgcgaaagcgacgcaccccgagacgacgcaggattcgtttgcgcccatgctt
cgcaacgtcaacgcgccgcccgacacggtgcacacggccttcaccaagaagatccgcgcg
atctttgaccgtgtccacaacgtgctgcagagccccgagggccatgcgctcgtggcgcct
gtccttgggtcgtcgctgcagtggacggtcggtgacgcggtctttgtcatccgcgtcagc
gccgagagcaagacggtgctgatcggacgaccattgacgccggtcgacctcgagattcgc
atgaccgagagtgacttcgtggcctttgtctcgggcagtttgcgcctcgagcgtgcgatc
tcgaccaagaagatggcgttcgtcggcaacatgaagctcgcgatgaagctccagccgttc
gtcaaggtgctggcgcaggcgcaggccggcctccagtcgcgcttgtag

DBGET integrated database retrieval system