KEGG   Staphylococcus pasteuri: STP1_0556Help
Entry
STP1_0556         CDS       T02889                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
spas  Staphylococcus pasteuri
Pathway
spas00010  Glycolysis / Gluconeogenesis
spas00071  Fatty acid degradation
spas00280  Valine, leucine and isoleucine degradation
spas00310  Lysine degradation
spas00330  Arginine and proline metabolism
spas00340  Histidine metabolism
spas00380  Tryptophan metabolism
spas00410  beta-Alanine metabolism
spas00561  Glycerolipid metabolism
spas00620  Pyruvate metabolism
spas00625  Chloroalkane and chloroalkene degradation
spas01100  Metabolic pathways
spas01110  Biosynthesis of secondary metabolites
spas01120  Microbial metabolism in diverse environments
spas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP1_0556
   00053 Ascorbate and aldarate metabolism
    STP1_0556
   00620 Pyruvate metabolism
    STP1_0556
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STP1_0556
   00561 Glycerolipid metabolism
    STP1_0556
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STP1_0556
   00310 Lysine degradation
    STP1_0556
   00330 Arginine and proline metabolism
    STP1_0556
   00340 Histidine metabolism
    STP1_0556
   00380 Tryptophan metabolism
    STP1_0556
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STP1_0556
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STP1_0556
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STP1_0556
Enzymes [BR:spas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     STP1_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AGZ24867
LinkDB All DBs
Position
complement(620708..622135)
Genome map
AA seq 475 aa AA seqDB search
MRHFTKQYINGEWVDSASGETIEVINPATEEVIGSVAKGNEEDVNKAVEAADNVYLDFRH
STVEYRRDLLDKIVKEYENRKEDIVQAITDELGAPLSVSEKVHYQMGLNHFTAARDALDS
FEFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSTVVLKPSEETPFAAI
ILAEIFDEVGVPKGVFNLVNGDGEGVGNPLSDHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIEEAAKATTGKVVNNTGQVCTAGTRVLVPNSIKEDFLKAVK
AQFSSVKVGDPREEGTQVGPIISKKQFDQVQSYIDKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNHMTIAQEEIFGPVMSVITYNDLDEAIKIANDTKYGLAGYVIGNDKDTLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagacatttcactaaacaatatataaatggtgaatgggttgatagtgctagtggtgaa
acaatagaagtaattaaccctgcaactgaagaagtcattggttcagtggctaaaggtaat
gaagaagatgttaataaagcagttgaagctgcagataatgtttatttagatttccgtcat
agtacggttgaatatagaagagatttattagataaaatcgttaaggaatatgaaaataga
aaagaagatattgtacaagcgattactgatgaacttggtgcgccattatcagtttctgaa
aaagtacattatcaaatgggacttaatcatttcactgcagctagagatgctttagacagt
tttgaattcgaagagcaacgtggcgatgatttagttgtcaaagaagcaattggtgtagca
ggattagttacgccatggaatttcccaactaaccaaacatcacttaaattagcggcagca
tttgcagcaggaagtactgtggtattaaaaccttcagaagaaacaccatttgctgcaatt
atcttagctgaaatctttgatgaagttggtgtgcctaaaggtgtatttaaccttgttaat
ggtgacggtgaaggtgtaggtaatccgttaagtgatcatcctaaagttagaatgatgtca
tttacaggttcaggcccaactggttcaaaaattatggaaaaagcagctaaagatttcaaa
aaagtatcactagaacttggtggcaaatcaccttatatcgttttagatgacgttgatatt
gaagaggcagctaaagcaacaacaggtaaagttgtcaataatactggtcaagtatgtact
gcaggtacacgtgtattagtaccaaatagtatcaaagaagacttcttaaaagctgtaaaa
gcacaatttagttctgttaaagtcggtgatcctagagaagaaggtacacaagttggaccg
attattagtaaaaaacaatttgaccaagttcaatcgtatattgataaaggtattgaagaa
ggcgcagaattattctatggaggacctggtaaacctgaaggtctagaaaaaggatatttt
gctcgtcctactatttttattaacgttgataatcatatgacaattgctcaagaggaaatt
tttggtcctgttatgtcagtgattacttataatgatttagacgaggcaattaaaatagcc
aatgatacgaaatatggtctagctggttatgtcattggtaatgataaagacacattacac
aaagtggcacgttcaattgaagctggaacagttgaaattaatgaagctggacgtaaacca
gatctaccgtttggtggttataaacaatctggattaggtcgtgaatggggcgactacgga
attgaagaattcttagaagtaaaatcaattgcaggttattttaaataa

DBGET integrated database retrieval system