KEGG   Staphylococcus pasteuri: STP1_0826Help
Entry
STP1_0826         CDS       T02889                                 

Definition
(GenBank) putative sodium ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
spas  Staphylococcus pasteuri
Brite
KEGG Orthology (KO) [BR:spas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spas02000]
    STP1_0826
Transporters [BR:spas02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    STP1_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 SMC_N AAA_23 SbcCD_C YozD
Motif
Other DBs
NCBI-ProteinID: AGZ25136
LinkDB All DBs
Position
complement(858016..858915)
Genome map
AA seq 299 aa AA seqDB search
MSLHIDHVTKKFNQFTAVNDISIHLEKGKMLGFLGRNGAGKTTTFRMILGLSEPTEGHIT
YDGHAIDQSMYNRIGYLPEERGLHPKMTVEDELTYLATLKGMSKSDIKKNIDYWLKRFAI
TENRHKRIDALSKGNQQKIQLLASMLHQPELLILDEPFSGLDPVNVELLKSAVKDLNDQG
STIIYSSHRMEHVEELCDDVCILNHGELVVSGDIHDVKASHGYKQVIIETDKSMPDITGI
EGVMSVETNKRHIKVTIQDESVAEKIYHHVISYGYVRRFQVLEPSLKDIFIDKVGDLHE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcattacatattgatcatgtgacgaagaagttcaatcaatttacggcagtcaatgat
atttccatccatcttgaaaaagggaaaatgcttggctttttaggacgtaatggtgcaggt
aagacaaccacctttagaatgatattaggattaagcgaacctactgaaggacacattaca
tatgatggtcatgcgattgatcagtcaatgtataatcgaattggctacttacctgaagaa
cgtggtttacatcctaaaatgactgtggaagatgaactaacttatcttgcaacacttaaa
gggatgtccaaatcagatattaagaaaaatattgattattggctcaaacgatttgccata
acagaaaatcgtcataaacgtattgatgcgttatccaaaggtaatcaacaaaaaattcaa
ttattagcaagtatgttgcatcaaccggaattgctgatattagatgaaccttttagtgga
ttagaccctgttaatgttgaattactcaaatcagctgtaaaagatttaaatgatcaaggt
tcaacaattatttatagttctcatcgtatggaacatgttgaagaattatgtgacgatgta
tgtatcttgaaccatggtgaacttgtggtatctggtgacatacatgacgtgaaggcctca
catggttataagcaagttatcatcgaaactgataaatcaatgcctgacataacaggtatt
gaaggtgtgatgagtgttgaaacaaataaacgtcatatcaaagtgacgatacaagatgaa
tccgttgcagaaaaaatatatcatcatgtcatctcatatggatatgtacgtcgtttccaa
gtgttagaaccttcccttaaagacatctttattgataaggtgggtgatttgcatgaataa

DBGET integrated database retrieval system