KEGG   Streptococcus pantholopis: A0O21_00955Help
Entry
A0O21_00955       CDS       T05054                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spat  Streptococcus pantholopis
Pathway
spat00220  Arginine biosynthesis
spat00250  Alanine, aspartate and glutamate metabolism
spat00290  Valine, leucine and isoleucine biosynthesis
spat01100  Metabolic pathways
spat01110  Biosynthesis of secondary metabolites
spat01130  Biosynthesis of antibiotics
spat01210  2-Oxocarboxylic acid metabolism
spat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A0O21_00955
   00290 Valine, leucine and isoleucine biosynthesis
    A0O21_00955
   00220 Arginine biosynthesis
    A0O21_00955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spat01007]
    A0O21_00955
Enzymes [BR:spat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     A0O21_00955
    2.6.1.66  valine---pyruvate transaminase
     A0O21_00955
Amino acid related enzymes [BR:spat01007]
 Aminotransferase (transaminase)
  Class I
   A0O21_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Alliinase_C Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AND78694
UniProt: A0A172Q5G7
LinkDB All DBs
Position
199141..200355
Genome map
AA seq 404 aa AA seqDB search
MKTVEKSSKLEHVAYDIRGPVLDEANRMMANGEQILRLNTGNPAEFGFTAPDEVIRDLIL
NARNSEGYSDSKGIFSARKAIMQYCQIKGFPKVDVDDIYIGNGVSELITMSMQGLLDDGD
EVLIPMPDYPLWTAAVSLAGGHAVHYLCDEKAEWYPDIADIKAKISSNTKAIVVINPNNP
TGALYPKDILEEIVDIARQNDLLIFADEIYDRLVMDELQHTAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKKHVKDYIEGLNMLANMRLCSNVLSQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYQAINDIPGLSAVKPKAGLYIFPKIDQTMYRIDDDEQFVLRLLQKEK
VMLVHGRGFNWKDPDHFRIVYLPRVEELASVQEKISRVLHHFRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgttgagaaatcatcaaaattagaacatgtcgcttacgatatccggggaccg
gttttagatgaggccaaccgcatgatggctaatggtgaacagattctgcgtcttaatacc
ggcaatcccgctgaatttggttttacagcaccggatgaagtcattcgtgacctcatttta
aatgcccgcaacagtgaaggctattcagacagcaaagggattttttctgcccgcaaagct
attatgcagtactgccagattaagggatttccaaaagtcgatgttgatgatatctatatc
ggcaacggtgtctcagaattaattaccatgagtatgcaggggctgcttgatgatggcgat
gaggtactgattcccatgcctgattatccgctgtggactgctgcggtcagtctggcaggc
ggacatgctgttcactatctttgtgacgagaaagcagaatggtaccccgatattgctgac
ataaaggcaaaaataagctctaatactaaagctatcgttgttatcaaccccaataatcca
acaggcgccctatatcctaaggatattctagaagaaattgttgatattgcccgacagaat
gatctgctgatttttgccgatgaaatctatgaccggctggtcatggacgaactgcagcac
acagctattgccagcctagcaccagatgtcttttgtgtttcgatgaatggcctatcgaag
tctcaccgtattgcaggtttccgcgtcggctggatggtcttgtccggaccgaaaaaacat
gtcaaagactatattgaggggctgaacatgctggctaatatgcgtctgtgctccaatgtt
ttatcccagcaggttgtgcagacttctttgggcgggcatcagtcagtagatgaacttttg
ctgccgggcggccggatttatgagcagcggaattttatctatcaggctattaacgatatt
cctggtctgtcagccgtcaaaccaaaagcaggcttgtatattttcccaaaaattgatcaa
actatgtaccgcattgatgatgacgaacagtttgttctgcgcctgctgcaaaaagaaaaa
gtcatgcttgtgcatggccgcggctttaattggaaagatcccgaccatttccgcattgtc
tatctgccgagagtagaagaactggcatccgttcaagaaaaaatctcacgggtcctgcac
cacttccgccggtaa

DBGET integrated database retrieval system