KEGG   Streptococcus pantholopis: A0O21_02485Help
Entry
A0O21_02485       CDS       T05054                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
spat  Streptococcus pantholopis
Pathway
spat00500  Starch and sucrose metabolism
spat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spat00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A0O21_02485
Enzymes [BR:spat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A0O21_02485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AND78965
UniProt: A0A172Q6D6
LinkDB All DBs
Position
509006..510472
Genome map
AA seq 488 aa AA seqDB search
MVNETMMQAFEWYLPADGGHWRRLQEDLPLFQKLGLTKIWLPPAFKGTSADDVGYGVYDL
FDLGEFDQNGTVRTKYGSKEDYLALVESLKQAGIMPIADIVLNHKANGDKKERFSVLRMD
PDNRQNPLSQPFEIEAWTEFTFPGRHGTYNDFNWHWYHFTGVDYDALHDETGIYLILGDN
KGWADQSRIDNENGNFDYLMYDDLDFKHPEVVNHLKDWAGWFLTATQIGGFRLDAVKHID
SEFMADFIQYIRTSINPDLYVFGEYWKNDAGMTQDYLEQVGETFSLVDVVLHMNFYEAGQ
KGSQFNLSAVLDGSLMQANPDLAVTFVDNHDSQRGQALESTVEEWFKPLAYALILLRQQG
LPCIFYGDYFGISGDFAQQDFRQLLDKLTFLRQYYVYGEQVDYFDHPNCIAWTCLGSEEH
PHGLAVLLSNSDKGWKNVNMGTFNQGKVFIDYLGNCPDEVVIGQDGWAEFPVEAGSVSAW
LDKDSLIN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgaaacgatgatgcaggcttttgagtggtatctgcctgcagatgggggacat
tggcgccgtctgcaggaggacttgcctctttttcaaaaattaggactgactaaaatctgg
ctgccgccggcttttaaggggacaagtgcagatgatgtcggttatggtgtctatgactta
tttgatctgggagaatttgatcaaaacggtactgtcaggacaaaatacggcagtaaagaa
gattatctggctcttgttgagtctttgaaacaagctggcattatgccgattgctgatatt
gtgctgaatcataaggccaatggagacaagaaggagcggttttccgtcctcaggatggat
ccggacaaccgtcagaacccgctgtctcaaccctttgaaattgaagcctggactgagttt
acctttcccggacggcacggcacttataatgatttcaattggcattggtaccattttaca
ggggtagattatgacgccctgcatgatgaaacagggatctatcttatcttgggagataac
aaaggctgggcggatcaaagccgtatcgataatgaaaatggcaattttgattatctgatg
tatgatgaccttgattttaaacatccagaagtggttaatcatctgaaagactgggcgggc
tggtttttaacagcaactcagataggaggtttccggctggatgcggttaagcatattgac
tcggagttcatggctgattttattcaatatatccgcacgtctatcaatcctgatctttat
gtttttggggagtattggaaaaatgatgcgggtatgacgcaggactatcttgaacaggtg
ggagaaacattcagtttggtcgatgtcgtcctgcatatgaatttttatgaagccgggcaa
aaaggcagccagtttaatctttctgcagttcttgatggcagcctgatgcaggcaaatcct
gatttagcggttacttttgtggataatcacgattcacagcgaggacaggctttagagtca
acggtagaggaatggttcaagcctctggcttatgcgctgattcttttgcgccagcaaggt
ctgccttgtattttttacggtgattatttcggtatttcaggagattttgcccagcaggat
tttcgccagcttctggataagttaacgtttttacggcagtattatgtctacggtgagcag
gtggattatttcgatcatcctaactgtattgcctggacctgtttaggcagtgaagagcat
ccgcacggtttggctgttttactcagtaacagtgacaagggatggaagaacgttaatatg
ggaacgttcaatcaaggcaaagtctttattgactatttggggaactgccctgatgaggtg
gtaatcggtcaggacggttgggccgaatttccagtcgaagcaggttctgtttctgcttgg
ctagataaagacagcctgataaactga

DBGET integrated database retrieval system