KEGG   Streptococcus pantholopis: A0O21_05745Help
Entry
A0O21_05745       CDS       T05054                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spat  Streptococcus pantholopis
Pathway
spat00010  Glycolysis / Gluconeogenesis
spat00020  Citrate cycle (TCA cycle)
spat00620  Pyruvate metabolism
spat01100  Metabolic pathways
spat01110  Biosynthesis of secondary metabolites
spat01120  Microbial metabolism in diverse environments
spat01130  Biosynthesis of antibiotics
spat01200  Carbon metabolism
Module
spat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0O21_05745
   00020 Citrate cycle (TCA cycle)
    A0O21_05745
   00620 Pyruvate metabolism
    A0O21_05745
Enzymes [BR:spat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A0O21_05745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B AP3D1
Motif
Other DBs
NCBI-ProteinID: AND79562
UniProt: A0A172Q814
LinkDB All DBs
Position
complement(1232017..1233405)
Genome map
AA seq 462 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDAVSEGDILLEIMSDKTNMELEAEESGVLVKIT
RKAGEVVPVTEVIGYIGAEGETVETETDSVPAQKDQAAEDGLTTAVKEPVSPAPAAPELH
SNENSVRATPAARKAAETLGLALELVPGTGANGRIHKEDVENFKSAQPKATPLAHRIALD
KGVALDTIKGTGVNGKIVKDDILAVLSAEQKEEAAPAKAVEKKEAELPEGVEIIKMSAMR
KAISKGMTHSYLTAPTFTLNYDIDMTNLMALRKQILEPIMNKTGFKVTFTDLIGMATVKT
LMKPEHRYMNASLINDAQEIELHQFVNLGIAVGLDDGLIVPVVHGADKMSLSDFVVASKE
VIKKAQSGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATVQTPVVLDGQ
VAIRPIMGLSLTIDHRLVDGMNGAKFMVDLKNLLENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattataatgcctaaactaggcgttgacatgcaagaaggcgaaatcatt
gaatggaaaaagcaggaaggtgatgccgtcagtgaaggggatattcttcttgaaatcatg
tcagataaaacaaacatggaactggaagctgaagaatcgggtgtgctggtaaagataacc
cgcaaagcaggcgaagtagttccggttacagaagtcatcggctatattggagccgaaggc
gaaacggtagagactgagacggattctgtccctgctcaaaaagatcaggcggcagaagat
ggcctgacaactgcagttaaagaacctgtcagcccagctccggctgctccagagcttcac
agcaatgagaacagtgtccgtgcgacaccggctgcacgtaaagctgccgaaacgctcggt
ctggcgcttgaattggttccgggaaccggcgctaacggtcgtattcataaggaagatgtt
gaaaacttcaaatctgcccagcctaaagcaactccacttgctcacagaatcgctttagat
aagggcgtcgcacttgacactattaagggaaccggcgttaatggtaaaattgtaaaagac
gatattttagctgttctgtcagctgagcagaaagaagaagcagctccggccaaagcggtt
gagaaaaaagaagcagagctcccagaaggggttgaaattatcaaaatgtctgctatgcgc
aaggcgatttctaaaggcatgacgcattcttacctaactgctcccacctttacgctcaat
tatgatattgacatgactaatctcatggcactgcgcaaacagatacttgagccgataatg
aacaaaacaggctttaaggtcacattcaccgatttgatcggtatggcgactgttaaaacc
ttgatgaagcctgaacaccgctatatgaatgcttccttaatcaacgacgcacaggaaatc
gaactgcatcaatttgttaatcttggtattgctgttggtttagatgacgggcttattgtt
cctgttgtccacggagcagataaaatgagtttgtcagactttgttgtggcctcaaaagag
gtcatcaaaaaagctcagtctgggaaactcaaagcggctgaaatgtccggatcgaccttc
tcgattaccaatttgggaatgtttgggacaaaatcatttaatccgattatcaatcagcct
aattcggctattcttggtgtatcggcaacggttcagactccagttgttctcgacggccag
gtggctattcggccgattatgggactgagcctgaccattgaccaccgcctggtcgatggc
atgaatggtgccaaatttatggtcgatctcaaaaatttattagaaaacccaatggaatta
ttgatttaa

DBGET integrated database retrieval system