KEGG   Streptococcus pantholopis: A0O21_06870Help
Entry
A0O21_06870       CDS       T05054                                 

Definition
(GenBank) hypothetical protein
Organism
spat  Streptococcus pantholopis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 Strep_his_triad LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-ProteinID: AND79767
UniProt: A0A172Q8M2
LinkDB All DBs
Position
1496827..1499718
Genome map
AA seq 963 aa AA seqDB search
MERSKKRLALVSLILTAHLVLGACQASQESKEEPLSQDKTAKQELKQSEEITVVAEILED
GYVMVHGNHYHVEKKAIPYNAKFLSDTLAPSDYQLKKKNIITKLEKGYIVKIDEDFCYYP
TDKEHKANIISIKEARKRTKYLKLEEHHGKKNKKNKKRKNKKKGYVEGIDKPTSDGFLLT
DESQITAKTDSGIIVEHNGHSHFFFYSDLVGSRWAYLIPKNYKQVPSQGTAGRSSSFQNG
AHDHYTFNPSDIVAEDANGYIVRHGDHYHYIPKSSLTGYFQTSQTLRQTLRQAGAPILSL
PQGRQAGYLPPLTNPLLSNGSIGQSVPPFPSQPLGRRAGIDYPTTDGFIFRGNGIVGRTD
LGLLVEHQGHTHLVTYESLKGTKWEALIEKKTKPSQPNNEPKKPELPPQTKPDQESDLEA
KRAYLAKSLNLPLSNIRVADTDNGKVFIYPHGDHEHAIAVDKISLNEPIEDPHAHQAIGI
ATLKSLGFDDDIIEDILHAQADTDFPGQETDPDKMKEWLKTVKYLNIGQRPNPLERKGLD
LMPNIEILGIGFTPIKDVRPLYQFKKLKHLWMTQTGISNYDFLKNLPTLEGIDISQNNVS
DLSFLKQYPQLKSVSAAGNHINDISVLAELPHLESLNLDYNHITDLSPLRGLSKLQAVSL
EHNQISDLSALSGKKDLKRLFVSHNPKINLNTLKAQSLEELTASHNEWTDLTFIKQLPSL
KNLNVEHNKLRSLAGLEEALSLEKLSAANNQIKEIGLSKDQASLLSLNLAHNQLKNLTGI
NHLKVLEDVDASHNLLSTLALSQSNHSIRHLNVSYNRIPQAELDLNEHNIPKVIADYFKS
AESGDISGNEAAPSTAEEGEQAAASQKTANEPEIPESTEAAETIQAESTETVSQAEAANQ
APYEEKNREETAVADANAEKNPEASQSKQETDPVSSDEEQDKDSKKLSEKTANNEADENE
QAS
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatcaaaaaaacggttagcactagtcagcttaatcttaacagcccatttggtt
ttaggagcttgccaggcaagtcaggaatcaaaagaagaacccttgtctcaagacaaaaca
gcgaagcaggagcttaaacaatctgaagagattacagtggttgccgaaattctggaagat
ggttatgtgatggtacatgggaatcattatcatgtggagaaaaaagccatcccttataat
gccaaatttctttcggatacgttagcaccatccgattaccaattgaagaaaaagaacatc
atcactaaactggaaaaaggctatattgtcaaaattgatgaagacttttgctattaccct
actgataaagagcataaagcaaatatcatcagcattaaagaagctcgaaaacgaaccaaa
tacctcaagcttgaagagcatcacggtaaaaagaataagaaaaacaagaagcggaaaaat
aagaaaaaaggctatgttgaagggattgataaaccaacgagtgatggttttcttttgacc
gatgagagccaaattacagctaagacggactccggaataatagttgagcataatgggcac
agccacttctttttctactcagatttggtgggcagcagatgggcttatttgattcccaaa
aattacaaacaagtcccaagccaagggaccgcaggacggtcttcttcttttcagaatgga
gctcatgatcattatacctttaaccccagcgacattgtcgccgaagatgccaatggctat
atcgtaaggcatggggaccactaccactatatcccaaaaagcagcctgacgggttatttt
cagaccagccagaccctgcggcaaacattgagacaagctggggcacctattctgtctctc
ccgcaaggcagacaagctggctacttgcctcctttaaccaatcctctgctatccaatggt
tcaattggacagtcagtgcctccattcccctctcagcctctgggaagacgggcaggtatc
gattacccaacaactgatggctttatctttagggggaacggtattgtcggacggacagat
ttgggactcttggttgaacatcaagggcatactcacctcgtcacctacgagagtctaaaa
ggaacgaaatgggaagctctgattgagaaaaaaactaaaccaagtcaaccgaacaacgag
cccaaaaagccggaacttccgccccagacaaaacctgatcaagaatcagatttggaagca
aaacgggcttatctggcaaaaagccttaacctgccattatcaaacattcgtgtagcagat
acggataatgggaaagtctttatttaccctcatggcgaccatgaacacgccattgctgtt
gataaaatttcacttaatgagcctatcgaagatccgcatgctcatcaagcgattggtata
gcaacgctgaaaagtttaggttttgatgatgacattattgaagatatcttacatgctcaa
gcagacacagacttccccgggcaagagaccgatcctgacaaaatgaaagaatggcttaaa
acagtcaagtacctcaatatcggacagcggccaaaccctcttgaacgaaaaggcttggat
ttgatgcctaatattgagatcttaggtattggttttacccctattaaagacgttcgtccc
ctctatcagtttaaaaagctgaaacatctatggatgacacagaccggcattagcaattat
gattttttgaaaaatttaccgactttagaaggaatagacatttcacaaaataatgtctca
gatctctcatttctaaaacaatacccgcagttaaaatcggtatccgcagccggcaatcat
ataaacgatatcagtgttttggcagaactgccgcatttagagtcgctcaatcttgactat
aatcatatcactgatctcagtcctttaagaggactgtccaaacttcaagccgtcagttta
gagcacaatcagatttccgatttatccgctctcagcggtaagaaagatttaaaacgtctc
tttgtgtcgcacaaccctaaaattaaccttaatacactgaaagcccaatcactggaagaa
ttaacagccagtcataatgaatggacagatttgacttttattaaacagcttccttctttg
aaaaatttgaacgtagaacacaataaactgcgttcactggcaggtttagaagaggctctc
tctttagaaaaattatctgctgccaataaccaaattaaagaaatcggtttatcaaaagat
caggccagtctgctttcgcttaatcttgctcacaatcagctgaagaatttaacaggtatc
aatcatttaaaagtcttagaagatgtagacgcttctcacaatcttctcagtacattagcg
ctcagtcagagcaaccattctattcgtcatttaaatgtcagttataaccgcatcccacaa
gcggaattggatttgaatgagcataatataccaaaagtgattgctgattactttaaatca
gcagagagcggcgatatcagcggaaatgaagcggctccttcaacagctgaggaaggggaa
caggcggcagcttctcaaaagacagcaaatgagcctgaaatcccagaaagtactgaagcc
gcagaaacaattcaggcagaatcaactgagaccgtctctcaggctgaagcagctaatcag
gcgccttatgaagaaaaaaacagggaagaaactgcggtagcagatgccaatgcagaaaaa
aatccggaagcatcccagtcaaaacaagaaacagatccggtctcttctgatgaagagcag
gacaaagacagcaagaagctttcagaaaaaacagccaataatgaagctgatgaaaacgaa
caggcttcttaa

DBGET integrated database retrieval system