KEGG   Streptococcus pantholopis: A0O21_07205Help
Entry
A0O21_07205       CDS       T05054                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spat  Streptococcus pantholopis
Brite
KEGG Orthology (KO) [BR:spat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spat01001]
    A0O21_07205
Enzymes [BR:spat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A0O21_07205
Protein kinases [BR:spat01001]
 Serine/threonine kinases: Other
  Bacterial family
   A0O21_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH RIO1 Kinase-like Haspin_kinase FTA2 Seadorna_VP7 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AND79815
UniProt: A0A172Q8U4
LinkDB All DBs
Position
complement(1566988..1568886)
Genome map
AA seq 632 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEEVAIKVLRTNYQTDQVAVTRFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVEGSDLKKYIQEHAPLSNNEVVRIMEEV
LSAMTLAHQQGIVHRDLKPQNILLTKNGTVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIGLNKNVP
QALENVVIKATAKRLSDRYSSTFEMSRDLMTALSYNRSREPKLVFNDHENTKTLPKVVPE
PSAVTAEADEKESSAVQNASTAADTKGSSPNKKKKAKKQKRLLGTVAKIAFAVFAVALAW
LAFVILRNPSTVSVPDVTGSTLAAAKKTIENSGLEVGDVHKIESTTVDRGKVVRTDPAAG
SSKKEGTRVDIYVSTGNSAFTMEDYTGQNYKEAMASLTENYGVSSSQIEIKEVAAGDYYD
EDTIVSQTPAAGETFNTAGDDKIRFEVASSNTVTMPDLTDYTYGDALDMLTGLGISTSRI
KTYTNDYTEITSPSLTAVISSQSPEAGYEIVLSGNDDIILYLYSSQSGDYSERSSSSSDG
SSSSSDSTEEEPEESSDGSSSSPDDSSSESSN
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattgttcgctggtcgttatcgtattttgaaatccattggacgg
ggcgggatggcagatgtttatttagccaatgacttgattttagataatgaagaagttgct
ataaaagtactgaggacaaattatcagacggatcaggttgctgtaacgcgtttccagaga
gaagcgcgagctatggctgaattgaatcatcctaatattgttgcaattcgcgatattgga
gaagaagacggccagcaatttttagtaatggaatatgttgaagggtccgacctaaaaaaa
tatatccaagagcacgctcctttatcaaataatgaagttgtcaggattatggaagaagtg
ctttctgccatgacactggcccatcagcaggggattgttcaccgggatcttaaacctcaa
aatattttactgaccaaaaacggaactgtaaaagttactgattttggaattgccgttgcc
tttgctgaaacaagtttgacacagaccaattcaatgctagggagtgtgcattatttgtcg
cctgaacaagcccgcggttctaaagccacggttcaaagtgacatctatgctatgggcatc
atgctctttgaaatgttaacaggccatattccctatgatggggacagcgctgttaccatt
gcactgcagcatttccaaaaaccgcttccgtcaattattggactgaataaaaatgtcccc
caggctcttgaaaatgtcgttattaaggctactgcgaaacggctgagtgatcgttattct
tcaacttttgagatgagccgggacctaatgacagctctcagttataatcgcagccgcgaa
cccaagttagtttttaacgaccacgaaaatacgaagaccttacctaaagtggttccggaa
ccttctgctgtcactgcagaagcagatgaaaaagaaagcagtgctgttcaaaatgcgagt
acagcagcagatactaaagggagcagtcctaataaaaagaagaaagcgaaaaagcagaaa
cgacttcttggtacagtggccaagattgcctttgctgtttttgctgttgctttggcctgg
ctggcctttgtcattctgcgcaatccatctacagtaagtgttcctgatgtgaccggttcg
acactagctgctgccaagaagacaattgaaaattcaggcctggaggtaggcgatgttcat
aagatagaaagtacaactgtggacagaggcaaggttgttcggactgatccggccgccggt
tcatcaaagaaggaaggaacgcgtgttgatatttatgtgtcgaccggcaattcggccttt
acaatggaagattataccggtcagaattataaggaggctatggccagtctgacagagaac
tatggcgtatcgtcatcgcagattgaaatcaaggaggttgcagcaggagactattatgat
gaagatacgatagtcagccaaactccagcagccggtgagaccttcaatactgccggtgat
gataagattaggtttgaagtggccagcagcaatactgtaacgatgcctgatttaactgac
tatacctatggcgatgctcttgatatgctgacaggtttgggtatttcgacttcacgcatt
aagacatatactaatgattataccgaaattacctctccatcacttacagctgtcatcagc
agccagagtccggaggccggttatgaaattgtcctctccggaaatgatgacattatcctc
tatctatattcttctcaaagcggggattattcagaaagatcctcttcatcttcagatggt
tcgtcttcaagcagtgattcgactgaagaagaaccagaagaaagttcagatggttcgtct
tcaagtccggatgattcttcatctgaatcatcaaattag

DBGET integrated database retrieval system