KEGG   Streptococcus pantholopis: A0O21_10410Help
Entry
A0O21_10410       CDS       T05054                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
spat  Streptococcus pantholopis
Pathway
spat00040  Pentose and glucuronate interconversions
spat00051  Fructose and mannose metabolism
spat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A0O21_10410
   00051 Fructose and mannose metabolism
    A0O21_10410
Enzymes [BR:spat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A0O21_10410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AND80350
UniProt: A0A172QA71
LinkDB All DBs
Position
2216887..2217828
Genome map
AA seq 313 aa AA seqDB search
MKLATRINSFLPSNANDLNKVLARFKALQLDYVDLNFPEHVEGYEAETVKAMLAANHLTV
NGLALRFRDPFINGELGNADSKVAQAALQLCKDAADYCRKLGGKVITIWLGYDGFDYSFQ
INYRKVWDQLVQAYQEICDYAKDLQISIEYKPFQPRAYAFVEGMGVTGMLLHDINRPNIG
VTLDYCHMLMKHENPAFAADIFGSRKELYGIHLNDGYGLNDDGLMVGTATPFKTLELLYY
LKKHDYSGVIYFDTFPVIEDAEEECARNIEMIHYLDSLIDQVGLDDIQTVIDKNDAVAAS
KLMLEFFKGRKNN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagcgacgcgaattaattcttttttgccatctaatgctaatgacctgaataag
gtcttggcgcgttttaaagccctgcagttagattatgttgacttaaatttcccggaacat
gttgaaggctatgaggcggaaacggtcaaggcgatgctggcagccaatcatttaacagtg
aatggcttagccttacgttttcgggatccttttatcaacggtgaattagggaatgcggac
tctaaagtggctcaggcagccttacagctgtgtaaagatgcggcagattattgtcggaag
ctcggcggaaaggtgattacaatttggctgggttatgatggctttgattatagttttcag
attaattaccgcaaggtctgggatcaattggtccaggcttatcaggaaatctgtgattat
gccaaggatttgcaaatcagtattgaatataaaccttttcagccgcgtgcgtatgccttt
gtagagggaatgggtgtaacagggatgctcctgcatgatattaaccgtcctaatataggg
gtaactctggactactgtcacatgctgatgaagcatgaaaatccagcttttgcagccgat
attttcggcagccgaaaggagctttacggcattcatttaaatgatggatacggccttaat
gacgacggattgatggtgggaaccgctacaccttttaagacgttggaacttttgtattat
ctgaaaaaacatgactattcaggagtgatttattttgatacctttcctgttattgaagat
gctgaagaggaatgtgcccgcaatatcgagatgattcactatctggacagtttgatcgat
caagtcggcttggatgacattcaaactgtcattgataaaaatgacgctgttgcagccagc
aagctgatgttagagttttttaagggaagaaaaaataattaa

DBGET integrated database retrieval system