KEGG   Streptomyces parvulus: Spa2297_05645Help
Entry
Spa2297_05645     CDS       T04685                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
spav  Streptomyces parvulus
Pathway
spav00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01130  Biosynthesis of antibiotics
spav01230  Biosynthesis of amino acids
Module
spav_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spa2297_05645
Enzymes [BR:spav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Spa2297_05645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Fe-ADH AAA Cytidylate_kin AAA_16 AAA_33 AAA_22 AAA_5 RuvB_N AAA_28 dNK NAD_binding_7 Cytidylate_kin2 RsgA_GTPase ABC_tran
Motif
Other DBs
NCBI-ProteinID: ANJ06519
UniProt: A0A191UUX3
LinkDB All DBs
Position
complement(1230040..1230561)
Genome map
AA seq 173 aa AA seqDB search
MSGAPLVVLVGPMGVGKSSVGRLLAERLGVGYRDTDEDIVAAEGRTIAEIFVDEGESAFR
ELEKNAVRAALSGHEGVLALGGGAVLDAGTRALLAAGQRVVYLSMDVEEAVRRTGLNAAR
PLLAVNPRKQWRELMEARRHLYEEAATVVVATDGRTPEEVTQAALDALELKEA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggggccccgctggtcgtcctcgtgggcccgatgggcgtgggcaagtccagcgtc
ggacggctgctggccgagcggctcggcgtgggctaccgggacacggacgaggacatcgtc
gcggccgaggggcggaccatcgccgagatcttcgtggacgagggcgagtccgccttccgg
gagctggagaagaacgccgtgcgcgcggcgctctccgggcacgagggagtcctcgcactc
ggcggcggcgcggtcctggacgccggcacgcgcgcgctgctcgccgccgggcagcgggtc
gtctacctctcgatggacgtcgaggaggccgtcaggcgcaccggtctgaacgcggcgcgc
ccgctgctggcggtcaacccgcgcaagcagtggcgcgaactgatggaggcccgccggcac
ctgtacgaggaggcggccacggtcgtcgtggccaccgacggccgcacgcccgaagaagtc
acccaagccgctctggacgcactggagttgaaggaagcatga

DBGET integrated database retrieval system