KEGG   Streptomyces parvulus: Spa2297_10135Help
Entry
Spa2297_10135     CDS       T04685                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
spav  Streptomyces parvulus
Pathway
spav00010  Glycolysis / Gluconeogenesis
spav00052  Galactose metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
Module
spav_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:spav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spa2297_10135
   00052 Galactose metabolism
    Spa2297_10135
Enzymes [BR:spav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spa2297_10135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: ANJ07332
UniProt: A0A191UXD0
LinkDB All DBs
Position
2183462..2184610
Genome map
AA seq 382 aa AA seqDB search
MELSRRTVIASAAAAGLAASAVGGTAHATGGRKPVKELFGRLTDGTKVYRWSLVNGGTRM
KVLSYGGVVQSLEIPDRRGRYANVSAGFSALDDYVASSPYFGALIGRYGNRIGRGRFTLD
GKAYQLSVNDGEQSLHGGAQGFDKRVWDVEPFTAGSDVGLVLYYTSVDGEMGYPGTLRAK
VTYTLTRRGEWRVDYEATTDKATVVNLTSHVYWNLAGEGSGTVEDHELSIAASRYTPTDA
GLIPTGELAGVAGTPFDFRRVKPVGRDIRDDHPQLVTAKGFDHNWVLDKGVTERPEHVAT
LRDPASGRTLRIATDQPGLQFYSGNFLDGTLTGTGGTLYRQGDALCLETQHFPDSPNQPS
FPSTVLRPGETYRTSTVHSFDA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaactgagcagacgcacggtcatcgcatcagcagcagccgccggcctcgccgcctcc
gcggtcggcggcacggcacacgccacgggaggcaggaagccggtgaaggagctcttcggc
agactcaccgacggcacgaaggtgtaccgctggtcgctggtgaacggcggcacgcggatg
aaggtgctgtcctacggcggagtcgtccagtccctggagatccccgaccgccggggccgg
tacgcgaacgtctccgcgggcttctccgccctcgacgactacgtggcgtccagcccgtac
ttcggcgccctcatcggccgctacggaaaccgtatcggccggggccgctttaccctggac
ggcaaggcgtaccagctctccgtcaacgacggcgagcagagcctgcacggcggtgcccag
ggcttcgacaagcgggtctgggacgtggagccgttcaccgcgggctccgacgtcggcctg
gtcctgtactacaccagcgtcgacggggagatgggctacccgggcacgctccgcgcgaag
gtgacgtacaccctcacccggcgcggcgagtggcgcgtcgactacgaggcgaccaccgac
aaggccaccgtcgtcaacctcaccagccacgtctactggaacctggccggtgagggcagc
ggcacggtggaggaccacgagctgtcgatcgccgcctcccgctacacgcccaccgacgcg
ggcctgatcccgaccggcgaactggcgggggtggcggggacgcccttcgacttccggcgg
gtgaagccggtcggccgggacatccgggacgaccatccgcagctggtcaccgccaagggc
ttcgaccacaactgggtgctggacaagggcgtcaccgagcgccccgagcacgtcgccacc
ctgcgcgacccggcctcgggccggaccctgcgcatcgccaccgaccagccgggcctgcag
ttctactcgggcaacttcctcgacggcaccctgaccgggaccggcggcacgctctaccgc
cagggcgacgccctgtgcctggagacgcagcacttcccggactcgccgaaccagccgtcg
ttcccgtcgacggtgctgcggccgggagagacgtaccggacctcgacggtgcactcgttc
gacgcgtga

DBGET integrated database retrieval system