KEGG   Streptomyces parvulus: Spa2297_10325Help
Entry
Spa2297_10325     CDS       T04685                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K04104  acyl-CoA carboxylase subunit beta [EC:6.4.1.-]
Organism
spav  Streptomyces parvulus
Pathway
spav00620  Pyruvate metabolism
spav00640  Propanoate metabolism
spav01200  Carbon metabolism
spav01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spa2297_10325
   00640 Propanoate metabolism
    Spa2297_10325
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Spa2297_10325
Enzymes [BR:spav01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.-  
     Spa2297_10325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans ACCA MdcE
Motif
Other DBs
NCBI-ProteinID: ANJ07367
UniProt: A0A191UXG6
LinkDB All DBs
Position
2225558..2226928
Genome map
AA seq 456 aa AA seqDB search
MTDRPSAREFLALVTDDFTELPRPAGQSPPDGPLGWPGYDAARARAAERTGEEESVVCGT
GRVAGVRAVLLAFEFGFLGGSLGRRTGDRLEAAYAHAREHRLPVVPLVATGGSRMQEGML
ALTQLQRVARESALTREAGLAQVAVVRDPATGGGWATLGAGADVVLALPGAQVGFAGSRV
RPPDADPAAYTAEAQVAAGSADAVVPAGELRSTLGRWLRLLTAGWDGPAPVPGPLGARDL
PVSGWDAVRRARAPGRPRAGAYLDAYFTHRAALSGDRCGGTDPDGMLCGFGEHAGRTVAY
AAQTGAATRPAGYRTATRLIRLAGRLGIPVLTLVDTPGAANDAEAEREGAGPAIAELFGA
VAAARTPVTTLVIGEGGSGGALALAAPGRTWATPDSYFSVIAPELAAAILKRGPGEVEAT
ADQLRLRPQDLAELGLTRTGDQLFPGTGDRRSEERM
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaccgcccgtccgcacgggagttcctggccctcgtcaccgacgacttcaccgaa
ctcccccgtcccgcgggccagtcgccgccggacggccccctgggctggcccggctacgac
gccgcccgcgcccgcgccgccgagcgcaccggggaggaggagtcggtggtctgcggcacc
gggcgggtggccggcgtgcgggccgtgctcctcgcgttcgagttcgggttcctcggcgga
tcgctgggccggcgcaccggtgaccggctggaggccgcgtacgcccacgcccgtgagcac
cggctgccggtggtgccgctggtcgccaccggcggcagccggatgcaggaggggatgctc
gcgctgacccagctccagcgggtggcacgggagtcggcgctcacccgggaggcggggctg
gcgcaggtcgccgtggtgcgggacccggcgaccggcggcggctgggcgaccctcggggcg
ggcgccgacgtggtcctcgcgctgcccggcgcccaggtcggcttcgccggttcgcgggtc
cggccgccggacgccgatccggcggcgtacacggccgaggcgcaggtggcggcgggcagc
gcggacgcggtcgtgccggccggcgagctgcgctccacgctgggccggtggctgcggctg
ctgacggccggctgggacggaccggcgccggtgcccgggccgctgggcgcacgggacctt
ccggtgagcggctgggacgcggtccggcgggcccgcgcccccggacgcccgcgcgccggg
gcctacctggacgcctacttcacccaccgcgccgccctctcgggcgaccggtgcggcggc
accgacccggacggcatgctgtgcggcttcggcgaacacgcggggcgcaccgtcgcgtac
gccgcccagacgggggcggccaccaggcccgccgggtaccgcaccgccacccggctgatc
cggctcgccgggcggctcggcatcccggtgctgaccctggtggacacgccgggcgcggcc
aacgacgcggaggccgaacgggagggggcgggaccggcgatcgccgagctgttcggggcg
gtggccgcggcgcgcacgccggtgaccacgctggtgatcggggagggcggttcgggcggg
gcgctggcactcgcggcgcccggccgcacctgggccacgccggacagctacttctcggtc
atcgcgccggaactcgcggcggcgatcctgaagcgcggccccggggaggtggaggccacg
gcggaccaactgcgcctgcgtccgcaggacttggccgagctgggactgacccgaacaggc
gatcagttgttccctggaacaggtgatcgtcgctctgaagagcgcatgtga

KEGG   Streptomyces parvulus: Spa2297_11760Help
Entry
Spa2297_11760     CDS       T04685                                 

Definition
(GenBank) acetyl/propionyl-CoA carboxylase subuit alpha
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
spav  Streptomyces parvulus
Pathway
spav00061  Fatty acid biosynthesis
spav00280  Valine, leucine and isoleucine degradation
spav00620  Pyruvate metabolism
spav00630  Glyoxylate and dicarboxylate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
spav01200  Carbon metabolism
spav01212  Fatty acid metabolism
Module
spav_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spa2297_11760
   00630 Glyoxylate and dicarboxylate metabolism
    Spa2297_11760
   00640 Propanoate metabolism
    Spa2297_11760
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Spa2297_11760
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_11760
Enzymes [BR:spav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Spa2297_11760
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Spa2297_11760
    6.4.1.3  propionyl-CoA carboxylase
     Spa2297_11760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp HlyD_3 HlyD_D23 ATP-grasp_3 RnfC_N GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: ANJ07617
UniProt: A0A191UY68
LinkDB All DBs
Position
2579937..2581898
Genome map
AA seq 653 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLRAMGVRSVAVFSDADADARHVREADEAVRIGPAPAAESY
LSVERLLEAAARTGAQAVHPGYGFLAENAGFARACEEAGLVFIGPPADAIALMGDKIRAK
ETVKAAGVPVVPGSSGSGLTDAQLADAAREIGTPVLLKPSAGGGGKGMRLVRDAAVLAEE
IAAARREARASFGDHTLLVERWIDRPRHIEIQVLADGHGNVIHLGERECSLQRRHQKIIE
EAPSVLLDEATRAAMGEAAVQAARSCGYRGAGTVEFIVPGSDPSSYYFMEMNTRLQVEHP
VTELVTGLDLVEWQLRVAAGEPLGLAQDDVRLTGHAVEARLCAETVSIKEGARGFLPSGG
TVLRLREPQGDGVRTDSGLSEGSEVGSLYDPMLSKVIAYGPDRETALRRLRAALARTVTL
GVQTNAGFLRRLLAHPAVVAGDLDTGLVEREADGLVSTDVPEEVYEAAAAVRLDALRPRG
DGWTDPFSVPDGWRTGGEPKPVAFPMRATGLEPVTHSPRGTHAVTDDQVAVTLDGVRHTF
DRAGDWLGRDGDAWHVRDHDPVAASLTRSAHAGADSLTAPMPGTVTVVKVAVGDEVAAGQ
SLLVVEAMKMEHVISAPHAGTVAELDVAPGTTVAMDQVLAVIAPAEGGEEQTA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacggtgctggtggccaaccgcggtgagatcgcggtgcgggtcatccggacg
ctgcgcgcgatgggcgtgcgctcggtggcggtcttctccgacgccgacgcggacgcccgg
cacgtgcgcgaggccgacgaggcggtacggatcggcccggcgccggcggcggagagctat
ctgtccgtcgagcggctgctggaggccgccgcccgcaccggcgcgcaggccgtccacccg
gggtacggcttcctcgccgagaacgccgggttcgcgcgggcctgcgaggaggcggggctg
gtcttcatcgggccgcccgccgacgcgatcgccctcatgggcgacaagatccgggccaag
gagacggtcaaggcggccggggtcccggtcgtcccgggctccagcggcagcgggctgacc
gacgcacagctcgccgacgcggcccgcgagatcggcacgccggtgctgctcaagccgtcg
gccggcgggggcggcaaggggatgcggctggtgcgggacgccgccgtgctcgccgaggag
atcgccgccgcccggcgcgaggcccgcgcctccttcggcgaccacacgctcctcgtggag
cgctggatcgaccggccccggcacatcgagatccaggtcctggccgacggccacggcaac
gtgatccacctgggcgagcgggagtgctccctccagcgccggcaccagaagatcatcgag
gaggcgcccagcgtgctcctcgacgaggcgacccgggccgcgatgggcgaggccgccgtg
caggcggcgcgctcctgcggctaccggggcgcgggcacggtggagttcatcgtgccgggc
agcgacccgtcgtcgtactacttcatggagatgaacacccgcctccaggtcgagcacccg
gtgaccgagctggtgacgggcctggacctggtggagtggcagctgcgggtggcggcgggc
gaaccgctcggcctcgcgcaggacgacgtccggctgaccgggcacgcggtggaggcccgg
ctgtgcgccgagactgtgtccatcaaagagggcgcgcgcggcttcctcccctccggcggc
accgtgctgcggctgcgcgagccccagggtgacggggtgcgcaccgactccgggctcagc
gagggcagcgaggtcggcagcctctacgacccgatgctgtccaaggtgatcgcctacggc
cccgaccgggagacggcgctgcgcaggctgcgggcggccctggcccggacggtgacgctg
ggcgtgcagaccaacgccgggttcctgcggcggctgctcgcgcacccggcggtggtggcg
ggcgacctggacaccgggctggtggagcgcgaggccgacggcctggtctccacggacgtg
ccggaggaggtgtacgaggcggcggcggccgtacggctggacgcgctgcggccgcgcggg
gacggctggaccgacccgttctcggtgccggacggctggcgcacgggcggcgagccgaag
ccggtggccttcccgatgcgggccacgggacttgaacccgtcacgcactccccgcgcggc
acccacgccgtcaccgacgaccaggtggccgtcaccctcgacggcgtccggcacaccttc
gaccgcgccggcgactggctgggccgcgacggcgacgcctggcacgtgcgcgaccacgac
ccggtcgccgcctccctcacccgctccgcccacgcgggcgccgactcgctcaccgcgccg
atgccgggcacggtgacggtggtgaaggtcgccgtcggcgacgaggtggccgccgggcag
agcctgctggtcgtggaggcgatgaagatggagcacgtcatctccgcgccgcacgccggc
accgtcgccgagctggacgtcgcgcccggcaccacggtcgccatggaccaggtgctggcg
gtcatcgccccggccgagggcggagaggagcagacggcgtga

KEGG   Streptomyces parvulus: Spa2297_20835Help
Entry
Spa2297_20835     CDS       T04685                                 

Definition
(GenBank) acetyl-/propionyl-CoA carboxylase subunit alpha
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
spav  Streptomyces parvulus
Pathway
spav00061  Fatty acid biosynthesis
spav00280  Valine, leucine and isoleucine degradation
spav00620  Pyruvate metabolism
spav00630  Glyoxylate and dicarboxylate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
spav01200  Carbon metabolism
spav01212  Fatty acid metabolism
Module
spav_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spa2297_20835
   00630 Glyoxylate and dicarboxylate metabolism
    Spa2297_20835
   00640 Propanoate metabolism
    Spa2297_20835
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Spa2297_20835
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_20835
Enzymes [BR:spav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Spa2297_20835
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Spa2297_20835
    6.4.1.3  propionyl-CoA carboxylase
     Spa2297_20835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 LAL_C2 HlyD_D23 Dala_Dala_lig_C HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ANJ09194
UniProt: A0A191V2H2
LinkDB All DBs
Position
complement(4563589..4565361)
Genome map
AA seq 590 aa AA seqDB search
MRKVLIANRGEIAVRVARACRDAGIASVAVYADPDRDALHVRAADEAFALGGDTPGTSYL
DIEKVLKAARESGADAVHPGYGFLSENAEFAQAVLDADLIWIGPPPHAIRDLGDKVAARH
IAQRAGAPLVAGTPDPVSGADEVVAFAEEHGLPIAIKAAFGGGGRGLKVARTLDEVPELY
DSAVREAVAAFGRGECFVERYLDKPRHVETQCLADQHGNVVVVSTRDCSLQRRHQKLVEE
APAPFLSQAQMDELYSASKAILKEAGYVGAGTVEFLVGMDGTISFLEVNTRLQVEHPVTE
EVAGIDLVREMFRIADGEKLGYDDPVLRGHSFEFRINGEDPGRGFLPAPGTVTLFDAPTG
PGVRLDAGVESGSVIGPAWDSLLAKLIVTGRTRKEALQRAARALDEFTVEGMATAIPFHR
AVVRDPAFAPELTGSSDPFTVHTRWIETEFVNEIKPFDAPADAEADEESGRETVVVEVGG
KRLEVSLPSSLGMSLARTGLAAGARPKRRAAKKSGPAVSGDTLASPMQGTIVKIAVEEGQ
EVQEGDLIVVLEAMKMEQPLNAHKSGTVKGLGAEIGASVTSGAAICEIKD
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaggtgctcatcgccaatcgtggcgaaatcgctgtccgtgtggcccgggcctgc
cgggacgcgggaatcgcgagcgtggccgtctacgcggacccggaccgggacgctctgcac
gtccgcgccgctgatgaggcgttcgccctgggtggtgacacccccgggaccagctatctg
gacatcgagaaggtcctgaaggccgcgcgggagtccggtgcggacgccgtacaccccggc
tacgggttcctctccgagaacgccgagttcgcgcaggcggtcctggacgcggacctgatc
tggatcggtccgccgccgcacgccatccgcgacctgggcgacaaggtcgccgcccggcac
atcgcgcagcgcgcgggcgccccgctggtggcgggcacccccgacccggtctccggcgcg
gacgaggtcgtcgccttcgccgaggagcacggcctgccgatcgcgatcaaggcggccttc
ggcggtggcggacgcggtctgaaggtcgcccgcaccctggacgaggtccccgagctgtac
gactccgccgtccgtgaggcggtggcggcgttcggccgcggcgagtgcttcgtcgagcgc
tacctcgacaagccccgtcacgtggagacccagtgcctggccgaccagcacggcaacgtg
gtcgtcgtctccacccgtgactgctccctccagcgccgccaccagaagctggtcgaggag
gccccggctcccttcctgtcgcaggcgcagatggacgagctgtactcggcgtccaaggcg
atcctgaaggaggccggctacgtcggcgccgggaccgtggagttcctcgtcggcatggac
ggcacgatctccttcctggaggtcaacacgcgcctccaggtcgagcacccggtcaccgag
gaggtcgccggcatcgacctggtccgcgagatgttccgcatcgccgacggcgagaagctg
ggctacgacgacccggtcctgcgtggtcactccttcgagttccgcatcaacggcgaggac
ccgggccgcggcttcctgcccgcccccggcaccgtcaccctcttcgacgcgcccaccggt
cccggcgtccgcctggacgcgggtgtcgagtccggcagcgtgatcggcccggcgtgggac
tccctgctggcgaagctgatcgtcaccggccggacccgcaaggaggccctccagcgcgcc
gcgcgcgccctggacgagttcacggtggagggcatggccacggccatcccgttccaccgc
gcggtcgtgcgcgacccggcgttcgccccggagctgaccggctccagcgacccgttcacg
gtccacacccggtggatcgagacggagttcgtcaacgagatcaagcccttcgacgcgccc
gccgacgcggaggcggacgaggagtcgggccgggagacggtcgtcgtcgaggtcggcggc
aagcgcctggaggtctccctgccgtccagcctgggcatgtccctggcccgcaccggcctc
gcggccggcgcccggcccaagcgccgcgcggcgaagaagtcgggccccgcggtctcgggc
gacaccctcgcctccccgatgcagggcacgatcgtcaagatcgccgtcgaggagggccag
gaggtccaggagggcgacctgatcgtcgtcctggaggcgatgaagatggagcagcccctc
aacgcccacaagtccggcaccgtcaagggcctgggcgcggagatcggcgcgtccgtgacc
tcgggcgccgcgatctgcgagatcaaggactga

DBGET integrated database retrieval system