KEGG   Streptomyces parvulus: Spa2297_11540Help
Entry
Spa2297_11540     CDS       T04685                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase (acylating)
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
spav  Streptomyces parvulus
Pathway
spav00280  Valine, leucine and isoleucine degradation
spav00410  beta-Alanine metabolism
spav00562  Inositol phosphate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Spa2297_11540
   00562 Inositol phosphate metabolism
    Spa2297_11540
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_11540
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spa2297_11540
Enzymes [BR:spav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     Spa2297_11540
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     Spa2297_11540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ANJ07575
UniProt: A0A191UY39
LinkDB All DBs
Position
complement(2525677..2527179)
Genome map
AA seq 500 aa AA seqDB search
MTNIVNHWIGGKTAEGASGTYGPVTNPATGEVTTKVAFASVDEVDTAVAVAKEAYLTWGQ
SSLAQRTTVLFKFRALLDAHRDEIAALITAEHGKVHSDALGEVARGLEIVDLACGINVQL
KGELSTEVATRVDVSSIRQPLGVVAGITPFNFPAMVPMWMFPLAIACGNTFVLKPSEKDP
SAAVRIAELLTEAGLPDGVFNVVHGDKVAVDRLLEHPDVKAVSFVGSTPIARYIHTTASA
NGKRVQALGGAKNHMLVLPDADLDAAADAAVSAAYGSAGERCMAISAVVAVGAVGDELVE
KIRERAEKIKIGPGDDPASEMGPLITKAHRDKVASYVEGAAAEGCEVVLDGTGHTVDGHE
DGHWIGISLLDRVPTTAKAYQDEIFGPVLCVLRADTYEEGVALINASPFGNGTAIFTRDG
GAARRFQLEIEAGMVGVNVPIPVPVGYHSFGGWKDSLFGDHHIYGNDGTHFYTRGKVVTT
RWPDPADAPAGVDLGFPRNH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacatcgtcaaccactggatcggcggcaagaccgccgaaggcgcctcgggcacg
tacggtccggtgaccaacccggccaccggcgaggtcaccaccaaggtcgccttcgcctcc
gtcgacgaggtggacaccgcggtcgccgtcgccaaggaggcgtacctgacctggggtcag
tcctcgctggcccagcggaccacggtcctcttcaagttccgggcgctgctggacgcgcac
cgcgacgagatcgccgcgctgatcaccgccgagcacggcaaggtgcactccgacgcgctc
ggcgaggtcgcccgcggcctggagatcgtcgacctggcctgcggcatcaacgtgcagctc
aagggcgagctgtccaccgaggtcgccacccgcgtcgacgtgtcctcgatccgccagccg
ctcggcgtggtcgccggcatcaccccgttcaacttcccggccatggtgccgatgtggatg
ttcccgctggccatcgcctgcggcaacaccttcgtgctcaagccgagcgagaaggacccc
tcggcggccgtgcggatcgccgagctgctcaccgaggccgggctgccggacggcgtcttc
aacgtcgtgcacggcgacaaggtggccgtggaccgcctccttgagcacccggacgtcaag
gccgtctccttcgtcggctcgaccccgatcgcccgctacatccacaccacggcctccgcc
aacggcaagcgcgtgcaggccctcggcggcgccaagaaccacatgctggtgctgccggac
gccgacctcgacgcggcggccgacgcggccgtgagcgcggcctacggctccgcgggggag
cgctgcatggcgatctccgcggtcgtcgcggtcggcgccgtcggcgacgaactcgtcgag
aagatccgcgagcgcgccgagaagatcaagatcggccccggcgatgacccggcctccgag
atgggccctctcatcaccaaggcccaccgcgacaaggtcgcctcctatgtcgagggcgcg
gcggccgagggctgcgaggtcgtcctggacggcaccggccacacggtcgacggccacgag
gacggccactggatcggcatctccctgctcgaccgggtgccgaccacggccaaggcctac
caggacgagatcttcggcccggtgctgtgcgtgctgcgcgcggacacctacgaggagggc
gtcgccctcatcaacgcctcgcccttcggcaacggcaccgcgatcttcacccgggacggc
ggcgcggcccgccgcttccagctggagatcgaggcgggcatggtcggcgtgaacgtgccg
atcccggtccccgtgggctaccactccttcggcggctggaaggactcgctcttcggcgac
caccacatctacggcaacgacggcacgcacttctacacccgcggcaaggtcgtcaccacc
cgctggccggacccggccgacgcccccgccggcgtggacctgggcttcccgcgcaaccac
tga

DBGET integrated database retrieval system