KEGG   Streptomyces parvulus: Spa2297_20005Help
Entry
Spa2297_20005     CDS       T04685                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
spav  Streptomyces parvulus
Pathway
spav00473  D-Alanine metabolism
spav01100  Metabolic pathways
spav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Spa2297_20005
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Spa2297_20005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spav01011]
    Spa2297_20005
Enzymes [BR:spav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Spa2297_20005
Peptidoglycan biosynthesis and degradation proteins [BR:spav01011]
 Precursor biosynthesis
  Racemase
   Spa2297_20005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANJ09044
UniProt: A0A191V221
LinkDB All DBs
Position
4377363..4378529
Genome map
AA seq 388 aa AA seqDB search
MSETAARRDAELRARAEIDLAALRANVRALRERAPGSALMAVVKADGYGHGAAPCARAAV
AAGATWLGTATPHEALALRADAGVPDDVRIMCWLWTPGGPWREAVEAGLDVSVSAPWALA
EATEGARLAGRPALVQLKADTGLGRGGCQPGADWEDLVGGALRAEAEGLVRVTGLWSHFA
CADEPGHPSIAAQLARFHEMTAYAERQGVRPDVRHIANSPATLTLPEAHFDLVRPGIAMY
GVSPSPEIGTPADLGLRPVMTLSAALALVKQVPGGHGVSYGHHYTTPGDTTLGLVPLGYA
DGVPRHASSTGPVLVDGKWRTVAGRIAMDQFVVDLGGDRPEPGAEAVLFGPGDRGEPTAE
DWAQAAGTIGYEIVTRIGSRVPRVYVNE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagacagctgctcggcgggacgcggaactgcgggcccgggccgagatcgacctg
gccgccctgcgggccaacgtgcgcgccctgcgcgaacgggcccccgggtcggccctcatg
gccgtcgtcaaggcagacggttacggccacggcgccgccccctgcgcccgcgcggccgtg
gcggccggcgcgacctggctgggcacggccaccccgcacgaggcgctcgccctgcgcgcg
gacgccggggtgcccgacgacgtacggatcatgtgctggctgtggacgccgggcggcccc
tggcgggaggcggtggaggccggtctcgacgtgtccgtcagcgccccctgggccctggcg
gaggccaccgagggagcccggctcgccggacgccccgctctcgtgcagctcaaggccgac
accggcctcggccggggcggctgccagccgggcgccgactgggaggacctggtcggcggt
gccctgcgcgccgaggccgagggcctggtgcgcgtcacggggctctggtcgcacttcgcc
tgcgccgacgagcccggacacccctccatcgcggcgcagctggcccgcttccacgagatg
accgcctacgccgagcggcagggcgtgcgccccgacgtccggcacatcgccaactcgccc
gccacgctcaccctccccgaggcccacttcgacctggtgcggcccggcatcgccatgtac
ggcgtctcgcccagccccgagatcggcaccccggccgacctcggcctgcggcccgtgatg
acgctgagcgccgcgctggccctggtcaagcaggtccccggcggacacggcgtgagctac
gggcaccactacacgacccccggcgacaccaccctcggcctcgtcccgctcggctacgcg
gacggcgtaccgcgccacgcctcctccaccggacccgtcctggtggacggcaagtggcgc
accgtcgcgggccggatcgcgatggaccagttcgtcgtcgacctcggcggcgaccggccc
gaaccgggcgccgaggcggtgctgttcgggcccggcgaccgcggcgagcccaccgccgag
gactgggcgcaggcggccggcaccatcgggtacgagatcgtcacccggatcggatcccgc
gtgccgcgcgtctacgtcaacgagtga

DBGET integrated database retrieval system