KEGG   Streptomyces parvulus: Spa2297_20260Help
Entry
Spa2297_20260     CDS       T04685                                 

Definition
(GenBank) methylmalonyl-CoA mutase
  KO
K01849  methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
spav  Streptomyces parvulus
Pathway
spav00280  Valine, leucine and isoleucine degradation
spav00630  Glyoxylate and dicarboxylate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
spav01200  Carbon metabolism
Module
spav_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Spa2297_20260
   00640 Propanoate metabolism
    Spa2297_20260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_20260
Enzymes [BR:spav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Spa2297_20260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ANJ09090
UniProt: A0A191V2E8
LinkDB All DBs
Position
4438923..4439339
Genome map
AA seq 138 aa AA seqDB search
MGVAAGPIRVVVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLHQTPEQIVDTAIQEDAD
AIGLSILSGAHNTLFAAVIALLRERDAADILVFGGGIIPEADIAPLKEKGVAEIFTPGAT
TASIVDWVRANVREHAEA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggcagccggtccgatccgcgtggtggtggccaagccggggctcgacggccac
gatcgcggggccaaggtgatcgcgcgggccctgcgtgacgccggtatggaggtcatctac
accggcctccaccagacacccgagcagatcgtggacaccgcgattcaggaggacgccgac
gcgatcggcctgtccatcctctccggtgcgcacaacacgctcttcgccgccgtgatcgcg
ctgctgcgggagcgggacgcggcggacatcctcgtcttcggcggcgggatcatccccgag
gcggacatcgctccgctgaaggagaagggcgtcgccgagatcttcacgcccggcgccacg
acggcgtcgatcgtggactgggtccgtgcgaacgtgcgggagcacgcggaggcctag

KEGG   Streptomyces parvulus: Spa2297_20575Help
Entry
Spa2297_20575     CDS       T04685                                 

Definition
(GenBank) methylmalonyl-CoA mutase
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
spav  Streptomyces parvulus
Pathway
spav00280  Valine, leucine and isoleucine degradation
spav00630  Glyoxylate and dicarboxylate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
spav01200  Carbon metabolism
Module
spav_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Spa2297_20575
   00640 Propanoate metabolism
    Spa2297_20575
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_20575
Enzymes [BR:spav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Spa2297_20575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-ProteinID: ANJ09143
UniProt: A0A191V2K4
LinkDB All DBs
Position
4505709..4507307
Genome map
AA seq 532 aa AA seqDB search
MARESGSARTTESGLPIEPVYGPGDQEGWDPAERLGEPGRYPFTRGVYPSMYTGRPWTMR
QYAGFGTATESNARYKQLIANGTMGLSVAFDLPTQMGHDSDAPIASGEVGKVGVAIDSID
DMRVLFGGIPLDKVSTSMTINAPASLLLLLYQLVAEEQGVSADRLTGTIQNDVLKEYIAR
GTYIFPPKPSLRLIADIFKYCRAEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIEYV
RTAVAAGMDVDDFAPRLSFFFVARTTILEEVAKFRAARRIWARVMREEFGAKNPKSLMLR
FHTQTAGVQLTAQQPEVNLVRVAVQGLGAVLGGTQSLHTNSFDEAIALPTDKSARLALRT
QQVLAYETDVTATVDPFAGSYVVEKMTDDVEAAALELMAKVEDLGGAVNAIEHGFQKSEI
ERSAYRIAQETDAGERVVVGVNRFQLDEEEPYEPLRVDPAIEAQQAERLARLRAERDQQA
VDTALAALKKAAEGEDNVLYPMKDALRARATVGEVCNALREVWGTYVPSDAF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgagtcgggcagtgcccggaccacggagagtggactgcccatcgagccggtc
tacgggcccggtgaccaggagggctgggacccggccgagcggctgggggagccggggcgg
taccccttcacgcggggtgtgtacccgtcgatgtacacgggccggccgtggacgatgcgc
cagtacgcgggcttcggtacggcgacggagtccaacgcccggtacaagcagctgatcgcc
aacggcacgatgggcctgtcggtggccttcgacctgcccacgcagatgggccacgactcg
gacgcgccgatcgccagcggtgaggtcggcaaggtcggtgtggccatcgactcgatcgac
gacatgcgggtgctgttcggcgggattccgctggacaaggtgtcgacgtcgatgacgatc
aacgcgccggcgtcgctgctgctcctgctgtaccaactggtggcggaggagcagggggtg
agcgccgacaggctcaccgggacgatccagaacgacgtgctgaaggagtacatcgcgcgt
gggacgtacatcttcccgccgaagccgtcgctgcggctgatcgcggacatcttcaagtac
tgccgggccgagatcccgaagtggaacacgatctcgatctcggggtatcacatggcggag
gcgggtgcctcgcccgcgcaggagatcgcgttcacgctggcggacggtatcgagtacgtg
cgtacggcggtcgcggcgggcatggacgtggacgacttcgcgccgcggctctcgttcttc
ttcgtggcgcgtacgacgattctggaggaggtcgcgaagttccgggcggcgcgccggatc
tgggcgcgggtgatgcgtgaggagttcggggcgaagaacccgaagtcgctgatgctgcgt
ttccacacgcagacggcgggggtgcagctgaccgcgcagcagcccgaggtgaacctggtg
cgggtggcggtgcagggtctgggggcggtgctgggcgggacgcagtcgctgcacaccaac
tccttcgacgaggccatcgcgctgcccaccgacaagtcggcccgcctggcgctgcgcacg
cagcaggtgctggcctacgagacggacgtgaccgcgaccgtcgacccgttcgccggctcc
tacgtcgtggagaagatgaccgacgacgtcgaggcggcggcgctggagctgatggccaag
gtcgaggacctcggcggcgcggtcaacgccatcgagcacggcttccagaagagcgagatc
gagcgctccgcctaccgcatcgcccaggagaccgacgccggggagcgggtcgtggtcggc
gtcaaccgcttccagctcgacgaggaggagccgtacgagcccctcagggtcgacccggcc
atcgaggcccagcaggccgaacgcctcgcccggctgcgcgccgaacgcgaccagcaggcc
gtcgacaccgcgctggcggcgctgaagaaggccgccgagggcgaggacaacgtcctctac
ccgatgaaggacgcgctgcgcgcccgcgccaccgtcggcgaggtctgcaacgccctgcgc
gaggtctggggcacctacgtcccctcggacgccttctga

KEGG   Streptomyces parvulus: Spa2297_22890Help
Entry
Spa2297_22890     CDS       T04685                                 

Definition
(GenBank) methylmalonyl-CoA mutase
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
spav  Streptomyces parvulus
Pathway
spav00280  Valine, leucine and isoleucine degradation
spav00630  Glyoxylate and dicarboxylate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
spav01200  Carbon metabolism
Module
spav_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Spa2297_22890
   00640 Propanoate metabolism
    Spa2297_22890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_22890
Enzymes [BR:spav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Spa2297_22890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-ProteinID: ANJ09570
UniProt: A0A191V3R8
LinkDB All DBs
Position
5022557..5024257
Genome map
AA seq 566 aa AA seqDB search
MDADAIEEGRLRWQARYDAARKRDADFTTLSGDPVEPVYGPRPGDEYEGFERIGWPGEYP
FTRGLHATGYRGRTWTIRQFAGFGNAEQTNERYKMILRNGGGGLSVAFDMPTLMGRDSDD
PRSLGEVGHCGVAIDSAADMEVLFKDIPLGDVTTSMTISGPAVPAFCMYLVAAERQGVDA
SVLNGTLQTDIFKEYIAQKEWLFQPEPHLRLIGDLMEHCAAGIPAYKPLSVSGYHIREAG
ATAAQELAYTLADGFGYVELGLSRGLDVDVFAPGLSFFFDAHLDFFEEIAKFRAARRIWA
RWMRDVYGAKTDKAQWLRFHTQTAGVSLTAQQPYNNVVRTAVEALAAVLGGTNSLHTNAL
DETLALPSEQAAEIALRTQQVLMEETGVANVADPLGGSWFIEQLTDRIEADAEKIFEQIK
ERGLRAHPDGQHPIGPITSGILRGIEDGWFTGEIAESAFRYQQSLEKDDKKVVGVNVHTG
SVTGDLEILRVSHEVEREQVRVLGERKAHRDDAAVRGALDAMLAAARSGANMIAPMLDAV
RAEATLGEICGVLRDEWGVYTEPAGF
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgacgccattgaggaaggccgccttcggtggcaggcccggtacgacgcggcg
cgcaagcgcgacgcggacttcaccacgctctccggcgaccccgtggagccggtgtacggg
ccccggcccggggacgagtacgaggggttcgagcggatcggctggccgggggagtacccc
ttcacccggggcctgcacgcgaccggctaccgggggcgtacgtggaccatccggcagttc
gccgggttcggcaacgccgagcagaccaacgagcgctacaagatgatcctccgcaacggc
ggcggcgggctctccgtcgccttcgacatgccgaccctgatgggccgcgactccgacgac
ccgcgctcgctcggcgaggtcggccactgcggggtggccatcgactcggccgccgacatg
gaggtcctgttcaaggacatcccgctcggcgacgtgacgacctccatgacgatcagcggg
cccgccgtgcccgccttctgcatgtacctggtcgccgccgaacggcagggcgtggacgcc
tccgtcctcaacggcacgctccagaccgacatcttcaaggagtacatcgcgcagaaggag
tggctcttccagcccgagccgcacctgcgcctgatcggcgatctgatggagcactgcgcg
gccggcatccccgcctacaagccgctctccgtctccggctaccacatccgcgaggccggg
gcgacggccgcgcaggagctggcgtacaccctggcggacggcttcgggtacgtggagctg
ggtctgtcgcgcggcctcgacgtcgacgtcttcgcccccggcctgtccttcttcttcgac
gcgcacctcgacttcttcgaggagatcgcgaagttccgcgcggcccggcgcatctgggcc
cgctggatgcgggacgtgtacggcgcgaagaccgacaaggcgcagtggctgcgcttccac
acccagaccgccggcgtctcgctgaccgcccagcagccgtacaacaacgtggtgcgtacg
gccgtggaggcgctcgcggcggtgctcggcggcaccaactcgctgcacaccaacgcgctc
gacgagaccctcgcgctccccagcgagcaggccgccgagatcgccctgcgcacccagcag
gtgctgatggaggagaccggcgtcgccaacgtcgccgacccgctgggcgggtcctggttc
atcgagcagctgacggaccggatcgaggccgacgccgagaagatcttcgagcagatcaag
gagcggggcctgcgggcccacccggacgggcagcacccgatcgggccgatcacctccggc
atcctgcggggcatcgaggacggctggttcaccggcgagatcgccgagtccgccttccgg
taccagcagtcgctggagaaggacgacaagaaggtggtgggcgtcaacgtccacaccggg
tccgtcaccggtgacctggagatcctgcgggtcagccacgaggtcgagcgcgagcaggta
cgggtgctcggcgagcgcaaggcccaccgggacgacgcggcggtgcgcggcgcgctggac
gcgatgctggcggcggcgcggtccggggccaacatgatcgccccgatgctggacgcggtg
cgcgcggaggcgacgctcggcgagatctgcggtgtgctgcgggacgagtggggggtgtac
acggagccggcgggcttctag

KEGG   Streptomyces parvulus: Spa2297_33210Help
Entry
Spa2297_33210     CDS       T04685                                 

Definition
(GenBank) methylmalonyl-CoA mutase
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
spav  Streptomyces parvulus
Pathway
spav00280  Valine, leucine and isoleucine degradation
spav00630  Glyoxylate and dicarboxylate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
spav01200  Carbon metabolism
Module
spav_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Spa2297_33210
   00640 Propanoate metabolism
    Spa2297_33210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_33210
Enzymes [BR:spav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Spa2297_33210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase PLAC9
Motif
Other DBs
NCBI-ProteinID: ANJ11962
UniProt: A0A191VAL3
LinkDB All DBs
Position
pSPA1:378200..379786
Genome map
AA seq 528 aa AA seqDB search
MENRRTTQSGLPIEPVYGPGDQEGWDPAERLGEPGRYPFTRGVYPSMYTGRPWTMRQYAG
FGTATESNARYKQLIANGTMGLSVAFDLPTQMGHDSDAPIASGEVGKVGVAVDSVDDMRV
LFGGIPLDKVSTSMTINAPASLLLLLYQLVAEEQGVSADRLTGTIQNDVLKEYIARGTYI
FPPKPSLRLIADIFKYCRAEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIEYVRTAV
AAGMDVDDFAPRLSFFFVARTTILEEVAKFRAARRIWARVMREEFGAKNPKSLMLRFHTQ
TAGVQLTAQQPEVNLVRVAVQGLGAVLGGTQSLHTNSFDEAIALPTDKSARLALRTQQVL
AYETDVTATVDPFAGSYVVEKLTDDLETEINTLLGRIEDLGGAVAAIEHGFQKDEIERSA
YRITQETDSGERVVVGVNRFQLDEEEPYEPLRVDPAIEAQQAERLARLRAERDQVAVDTA
LVALRKAAEGEDNVLYPMKDALRARATVGEVCNTLREVWGTHIPTDAY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccgaagaacaacacagtccggactgcccatcgagccggtctacgggcccggt
gaccaggagggctgggacccggccgagcggctgggggagccggggcggtaccccttcacg
cggggtgtgtacccgtcgatgtacacgggccggccgtggacgatgcgccagtacgcgggc
ttcggtacggcgacggagtccaacgcccggtacaagcagctgatcgccaacggcacgatg
ggcctgtcggtggccttcgacctgcccacgcagatgggccacgactcggacgcgccgatc
gccagcggtgaggtcggcaaggtcggtgtggccgtcgactcggtcgacgacatgcgggtg
ctgttcggcgggatcccgctggacaaggtctcgacgtcgatgacgatcaacgcgccggcg
tcgctgctgctcctgctgtaccaactggtggcggaggagcagggggtgagcgccgacagg
ctcaccgggacgatccagaacgatgtgctgaaggagtacatcgcgcgtgggacgtacatc
ttcccgccgaagccgtcgctgcggctgatcgcggacatcttcaagtactgccgggccgag
atcccgaagtggaacacgatctcgatctcggggtatcacatggcggaggcgggtgcctcg
cccgcgcaggagatcgcgttcacgctggcggacggtatcgagtacgtgcgtacggcggtc
gcggcgggcatggacgtggacgacttcgcgccgcggctctcgttcttcttcgtggcgcgt
acgacgattctggaggaggtcgcgaagttccgggcggcgcgccggatctgggcgcgggtg
atgcgtgaggagttcggggcgaagaacccgaagtcgctgatgctgcgtttccacacgcag
acggcgggggtgcagctgaccgcgcagcagcccgaggtcaacctggtgcgggtggcggtg
cagggtctgggggcggtgctgggcgggacgcagtcgctgcacaccaactccttcgacgag
gccatcgcgctgcccaccgacaagtcggcccgcctggcgctgcgcacgcagcaggtgctg
gcctacgagacggacgtgaccgcgaccgtcgacccgttcgccggctcctacgtggtcgag
aagctcaccgacgacctggagaccgagatcaacaccctcctcggcaggatcgaggacctg
ggcggtgcggtcgccgcgatcgagcacggcttccagaaggacgagatcgagcgcagcgct
taccgcatcacccaggagaccgactccggtgaacgcgtcgtcgtcggcgtcaaccgcttc
cagctcgacgaggaggagccctacgagcccctgcgggtcgacccggccatcgaggcccag
caggccgaacgcctcgcccggctccgtgccgagcgcgaccaggtggcggtggacaccgcg
ctggtggcgctgaggaaggccgccgagggcgaggacaacgtcctctacccgatgaaggac
gccctgcgcgcccgcgccaccgtcggcgaggtctgcaacacgctccgcgaagtgtggggc
acccacatccccacagacgcctactga

KEGG   Streptomyces parvulus: Spa2297_33215Help
Entry
Spa2297_33215     CDS       T04685                                 

Definition
(GenBank) methylmalonyl-CoA mutase
  KO
K01849  methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
spav  Streptomyces parvulus
Pathway
spav00280  Valine, leucine and isoleucine degradation
spav00630  Glyoxylate and dicarboxylate metabolism
spav00640  Propanoate metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
spav01200  Carbon metabolism
Module
spav_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Spa2297_33215
   00640 Propanoate metabolism
    Spa2297_33215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_33215
Enzymes [BR:spav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Spa2297_33215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding His_biosynth Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ANJ11963
UniProt: A0A191VAQ9
LinkDB All DBs
Position
pSPA1:379806..380222
Genome map
AA seq 138 aa AA seqDB search
MSSTSNAPLRVVVAKPGLDGHDRGAKVIARALRDTGVEVVYTGLHQAPRQIVDTAVQEDA
DAIGLSVLSGAHMTLFAEVLRLLREADAADITVFGGGIIPHEDVQSLLDLGVAALFTPGT
TTREVTDWVHANVTRTSA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccagcaacgccccactccgcgtcgtcgtcgccaagccgggcctggacggc
cacgaccgcggcgccaaggtgatcgcccgagccctccgggacaccggcgtcgaggtcgtc
tacaccggcctccaccaggcgccgcgccagatcgtcgacacggccgtccaggaggacgcc
gacgccatcggcctctccgtgctctccggcgcccacatgacgctcttcgccgaagtgctg
cggctgctgcgcgaggcggacgccgcggacatcaccgtgttcggcggcggcatcatcccg
cacgaggacgtccagtccctgctcgacctgggcgtggccgccctgttcacccccggcacc
accacccgggaggtcaccgactgggtccacgccaacgtcacccggacctccgcctga

DBGET integrated database retrieval system