KEGG   Streptomyces parvulus: Spa2297_20295Help
Entry
Spa2297_20295     CDS       T04685                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
spav  Streptomyces parvulus
Pathway
spav00020  Citrate cycle (TCA cycle)
spav00640  Propanoate metabolism
spav00660  C5-Branched dibasic acid metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
spav01200  Carbon metabolism
Module
spav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spa2297_20295
   00640 Propanoate metabolism
    Spa2297_20295
   00660 C5-Branched dibasic acid metabolism
    Spa2297_20295
Enzymes [BR:spav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Spa2297_20295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A HHH_5 DUF585
Motif
Other DBs
NCBI-ProteinID: ANJ09094
UniProt: A0A191V270
LinkDB All DBs
Position
4449950..4451134
Genome map
AA seq 394 aa AA seqDB search
MDLFEYQARDLFAKHDVPVLAGEVIDTPEAARAITERLGGKSVVKAQVKVGGRGKAGGVK
LAASADEAVARATDILGMDIKGHTVHKVMIAETAPEIVEEYYVSFLLDRANRTFLSIASV
EGGVEIEEVAATRPEAVAKTPIDAIEGVTPEKAREIVEAAKFPAEVADQVVNVLVKLWDT
FIKEDALLVEVNPLAKVASGEVIALDGKVSLDDNAEFRHPDFEELHDKAAANPLEAAAKE
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGDVKPANFLDIGGGASAQVMANGL
EIILGDPDVRSVFVNVFGGITACDEVANGIVQALKLLEDRGEKVEKPLVVRLDGNNAELG
RKILTDANHPLVQRVDTMDGAADKAAELAHAAAK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacgatgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcggcgcgcgcgatcaccgagcgtctgggcggc
aagtccgtcgtcaaggctcaggtgaaggtcggtggccgcggcaaggccggcggcgtgaag
ctcgccgcctcggcggacgaggccgtcgcccgcgcgacggacatcctcggcatggacatc
aagggccacacggtccacaaggtgatgatcgccgagaccgcccccgagatcgtcgaggag
tactacgtctccttcctcctcgaccgtgccaaccgcaccttcctctccatcgcctccgtc
gagggcggcgtggagatcgaggaggtggcggccacccgtccggaggccgtcgccaagacc
ccgatcgacgccatcgagggtgtgacccccgagaaggcgcgcgagatcgtcgaggccgcg
aagttcccggccgaggtcgccgaccaggtcgtgaacgtcctggtcaagctgtgggacacc
ttcatcaaggaggacgccctcctggtcgaggtcaacccgctggcgaaggtcgcctccggc
gaggtcatcgccctcgacggcaaggtgtcgctcgacgacaacgccgagttccgtcacccc
gacttcgaggaactccacgacaaggccgccgccaacccgctcgaggcggccgccaaggag
aagaacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggt
ctcgtgatgagcaccctggacgtcgtcgcgtacgccggtgagaagcacggcgacgtgaag
cccgccaacttcctggacatcggcggcggcgcctccgcccaggtcatggcgaacggcctg
gagatcatcctcggcgacccggacgtccgctccgtgttcgtcaacgtcttcggcggcatc
accgcgtgcgacgaggtcgccaacggcatcgtccaggcgctgaagctcctggaggaccgc
ggcgagaaggtcgagaagccgctcgtcgtccgcctcgacggcaacaacgccgagctgggc
cgcaagatcctcaccgacgccaaccacccgctggtccagcgcgtcgacaccatggacggc
gcggccgacaaggccgccgagctggctcacgccgccgccaagtaa

KEGG   Streptomyces parvulus: Spa2297_20300Help
Entry
Spa2297_20300     CDS       T04685                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
spav  Streptomyces parvulus
Pathway
spav00020  Citrate cycle (TCA cycle)
spav00640  Propanoate metabolism
spav00660  C5-Branched dibasic acid metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
spav01200  Carbon metabolism
Module
spav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spa2297_20300
   00640 Propanoate metabolism
    Spa2297_20300
   00660 C5-Branched dibasic acid metabolism
    Spa2297_20300
Enzymes [BR:spav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Spa2297_20300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ANJ09095
UniProt: A0A191V2F3
LinkDB All DBs
Position
4451163..4452047
Genome map
AA seq 294 aa AA seqDB search
MAIWLNKDSKVIVQGMTGATGMKHTKLMLGDGTEVVGGVNPRKAGTSVDFDGTEVPVFGT
VKEAIEKTGANVSVIFVPEKFTKDAVVEAIDAEIPLAVVITEGIAVHDSASFWAYAGKKG
NKTRIIGPNCPGIITPGQSNVGIIPGDITKPGRIGLVSKSGTLTYQMMYELRDIGFSTAV
GIGGDPIIGTTHIDALAAFEADPETDLIVMIGEIGGDAEERAADFIKANVTKPVVGYVAG
FTAPEGKTMGHAGAIVSGSSGTAQAKKEALEAAGVKVGKTPTETAKLAREILAG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctatctggctcaacaaggacagcaaggtcatcgtccagggcatgaccggcgccacc
ggcatgaagcacaccaagctcatgctgggtgacggcaccgaggtcgtgggcggcgtgaac
ccgcgcaaggcgggcacctccgtggacttcgacggcaccgaggtaccggtcttcggcacc
gtcaaggaggccatcgagaagaccggcgccaacgtctccgtcatcttcgtgccggagaag
ttcaccaaggacgccgtcgtcgaggccatcgacgccgagatcccgctggccgtcgtcatc
accgagggcatcgccgtgcacgactcggcgtcgttctgggcgtacgccggcaagaagggc
aacaagacccgcatcatcggcccgaactgccccggcatcatcaccccgggccagtccaac
gtcggcatcatcccgggcgacatcaccaagcccggccgcatcggcctggtctcgaagtcc
ggcacgctgacgtaccagatgatgtacgagctgcgcgacatcggcttctcgaccgccgtc
ggcatcggtggcgacccgatcatcggcaccacgcacatcgacgcgctcgccgcgttcgag
gccgaccccgagaccgacctgatcgtcatgatcggtgagatcggcggcgacgccgaggag
cgcgcggccgacttcatcaaggccaacgtgaccaagccggtcgtcggctacgtcgccggc
ttcaccgcgcccgagggcaagaccatgggccacgccggcgccatcgtctccggttcgtcc
ggcaccgcccaggcgaagaaggaggccctggaggccgcgggcgtcaaggtcggcaagacc
ccgaccgagacggcgaagctcgcccgggagatcctggccggctga

KEGG   Streptomyces parvulus: Spa2297_27430Help
Entry
Spa2297_27430     CDS       T04685                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
spav  Streptomyces parvulus
Pathway
spav00020  Citrate cycle (TCA cycle)
spav00640  Propanoate metabolism
spav00660  C5-Branched dibasic acid metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
spav01200  Carbon metabolism
Module
spav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spa2297_27430
   00640 Propanoate metabolism
    Spa2297_27430
   00660 C5-Branched dibasic acid metabolism
    Spa2297_27430
Enzymes [BR:spav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Spa2297_27430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ANJ10384
UniProt: A0A191V5T9
LinkDB All DBs
Position
6075074..6076216
Genome map
AA seq 380 aa AA seqDB search
MDLYEHQARELFAEHGIVVPRAEVTDSPARAREIARALGGRAVVKAQVKTGGRGKAGGVR
LAADPAAAEEAARHILGMDIKGHRVEAVMLAEPVDIQQEFYVSYVLDRAAGGFLAVASAE
GGTEIEEVAAERPEAVVRVPVDPAAGLTTPTAVRIADAAGLPPQSVDVLVRLWQVLVRED
ALLVEVNPLVRTVDGRIVALDGKVTLDDNALFRQTRWGERHATAADPLEARAAAKGLNYV
KLDGEVGVIGNGAGLVMSTLDVVAGCGARPANFLDIGGGASARVMADGLSVVLSDPAVKS
VLVNVFGGITACDAVADGIVRALDEVRPTKPIVVRLDGNSAARGRALLDARAHPLVEQAT
TMDGAASRAARHATAAPTAG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtacgaacaccaggcaagggaactcttcgcagaacacggcatcgtggtgccg
agggccgaggtcaccgactcgcccgcacgagcccgcgagatcgcccgcgcactcggcggc
cgcgccgtcgtcaaggcgcaggtgaagacgggcggacgcggcaaggccggcggcgtcagg
ctcgccgccgacccggccgcggccgaggaggccgcccggcacatcctcggcatggacatc
aagggacaccgggtcgaggcggtcatgctcgccgaacccgtcgacatccagcaggagttc
tacgtctcctacgtcctggaccgcgcggccggcggcttcctcgccgtcgcgtcggccgag
ggcggcacggagatcgaggaggtcgccgccgagcggcccgaggccgtggtccgcgtcccc
gtcgacccggcagccggcctcaccacgccgacggcggtgcgcatcgcggacgccgccggg
ctgcccccgcagagcgtcgacgtcctcgtccgcctctggcaggtgctggtccgcgaggac
gccctgctggtcgaggtcaacccgctcgtcaggaccgtcgacggccggatcgtggccctc
gacggcaaggtcaccctggacgacaacgccctcttccgccagacccgttggggtgagcgg
cacgccacggccgccgacccgctggaggcccgggccgccgcgaagggcctcaactacgtc
aagctcgacggcgaggtcggcgtcatcggcaacggcgccggactggtcatgtcgacgctc
gacgtcgtcgccggctgcggcgcccggcccgccaacttcctggacatcggcggcggcgcc
tccgcccgggtcatggccgacggactgtccgtcgtcctctccgaccccgccgtgaagtcc
gtactcgtcaacgtcttcggcggcatcaccgcctgcgacgcggtcgccgacggcatcgtc
cgcgccctggacgaggtccggccgaccaaaccgatcgtcgtacgcctcgacgggaacagc
gccgcccgcggccgggccctgctcgacgcgcgcgcccatcccctggtcgaacaggccacc
accatggacggcgccgcgagccgtgccgcccgccacgccaccgcggcgcccaccgccgga
tag

KEGG   Streptomyces parvulus: Spa2297_27435Help
Entry
Spa2297_27435     CDS       T04685                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
spav  Streptomyces parvulus
Pathway
spav00020  Citrate cycle (TCA cycle)
spav00640  Propanoate metabolism
spav00660  C5-Branched dibasic acid metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
spav01200  Carbon metabolism
Module
spav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spa2297_27435
   00640 Propanoate metabolism
    Spa2297_27435
   00660 C5-Branched dibasic acid metabolism
    Spa2297_27435
Enzymes [BR:spav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Spa2297_27435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ANJ10385
UniProt: A0A191V638
LinkDB All DBs
Position
6076255..6077157
Genome map
AA seq 300 aa AA seqDB search
MAIHLTKESKVLVQGMTGAEGMKHTRRMLAAGTDVVGGVNPRKAGRTVDFGERSVPVFGS
VREGVERTGADVTVVFVPPAFAKAAVTEAADAGIGLAVVITEGIPVHDSVAFTAHAKARG
TRVVGPNCPGLISPGQSNAGIIPPDITKPGPVGLVSKSGTLTYQLMYELREVGFSTCVGI
GGDPVVGTTHIDCLAAFEDDPDTELVVLIGEIGGDAEERAADYIRDHVTKPVVGYIAGFT
APEGRTMGHAGAIVSGSSGTARAKRAALEAAGVRVGSTPTETARHVLAALGRPARDGAGA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccacctcaccaaggagagcaaggtcctcgtccagggcatgaccggcgccgag
ggcatgaagcacacccgccggatgctggccgccggcaccgacgtcgtcggcggcgtcaac
ccgcgcaaggccggccgcaccgtcgacttcggcgaacgctccgtaccggtcttcggctcg
gtgcgcgagggcgtcgaacgcaccggcgccgacgtcaccgtcgtcttcgtcccgcccgcc
ttcgccaaggccgcggtgaccgaggcggccgacgccggcatcggcctggccgtcgtcatc
accgagggcatccccgtccacgactccgtcgcgttcaccgcccacgcgaaggcacgcggc
acccgcgtcgtcggccccaactgccccggcctgatcagcccggggcagtccaacgcgggc
atcatcccgcccgacatcaccaagccgggccccgtcggcctggtctccaagtccggcacc
ctcacctaccagctgatgtacgagctgcgcgaggtcggcttctccacctgtgtgggcatc
ggcggcgaccccgtcgtcggcaccacccacatcgactgcctcgccgccttcgaggacgac
ccggacaccgaactcgtcgtcctcatcggcgagatcggcggcgacgccgaggagcgcgcg
gccgactacatccgcgaccacgtcaccaagcccgtcgtcggctacatcgccgggttcacc
gcacccgagggccggaccatgggacacgccggcgccatcgtctccggctcctccggcacc
gcgcgggcgaagcgggccgcactggaggcggccggcgtccgggtcggcagcacccccacc
gagacggcgcggcacgtcctggccgcgctcgggcgccccgcacgcgacggagccggcgcg
tga

DBGET integrated database retrieval system