KEGG   Streptomyces parvulus: Spa2297_22230Help
Entry
Spa2297_22230     CDS       T04685                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
spav  Streptomyces parvulus
Brite
KEGG Orthology (KO) [BR:spav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Spa2297_22230
Enzymes [BR:spav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Spa2297_22230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ANJ09449
UniProt: A0A191V380
LinkDB All DBs
Position
complement(4870173..4870568)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVTVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcacggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaagcggagtcggtcaaggccgtccaggag
aagatggccggcaacgacgacccgcacttccaggcccgcgccacggtcatcaaggagcag
cgcgccgagctcgcgaagcaccacgtgtccgtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctctcg
gccgccaagggttcgaccgacccggcgaccggccagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system