KEGG   Streptomyces parvulus: Spa2297_22925Help
Entry
Spa2297_22925     CDS       T04685                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
spav  Streptomyces parvulus
Pathway
spav00430  Taurine and hypotaurine metabolism
spav00620  Pyruvate metabolism
spav00640  Propanoate metabolism
spav00680  Methane metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
spav01200  Carbon metabolism
Module
spav_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spa2297_22925
   00640 Propanoate metabolism
    Spa2297_22925
  09102 Energy metabolism
   00680 Methane metabolism
    Spa2297_22925
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Spa2297_22925
Enzymes [BR:spav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Spa2297_22925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ANJ09577
UniProt: A0A191V3R9
LinkDB All DBs
Position
complement(5031227..5032441)
Genome map
AA seq 404 aa AA seqDB search
MSPTRVLVLNSGSSSVKYQLLDMRGGDRLAVGLVERIGEETSRLKHTPEGGESREWSGAV
PDHESALKAVAAELAKDGLGLDSPELAAIGHRVVHGGRRFTEPTVIDDAVLAEIERLIPV
APLHNPANLTGIRTARDLRPDLPQVAVFDTAFHTTMPESAARYAIDVETADAHRIRRYGF
HGTSHAYVSRETARLLGRAPEDVNVIVLHLGNGASASAVRGGRCVDTSMGLTPLEGLVMG
TRSGDLDPAVIFHLMRVGGMSADEIDTLLNKRSGLIGLCGDNDMREIRRRVDAGDERARL
AFDIYIHRLKKYIGAYYAVLGRVDAVVFTAGVGENAAAVREAAVAGLEGLGLAVDGELNA
GRGDGARLVSPPDARVAVAVVPTDEEMEIATQTYALVKESGNPA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgacccgcgtcctcgtcctcaactccggctcctcgtcggtcaagtaccagctg
ctcgacatgcgcggcggcgaccggctggccgtgggcctcgtcgagcggatcggcgaggag
acctcgcggctgaagcacacgccggagggcggcgagagccgtgagtggagcggcgccgtc
cccgaccacgagtccgcgctgaaggccgtggccgccgagctggccaaggacggcctcggc
ctggactcgccggagctggccgcgatcggacaccgcgtggtgcacgggggccggcggttc
accgagccgaccgtgatcgacgacgccgtgctcgccgagatcgagcggctgatcccggtc
gccccgctgcacaacccggccaacctcaccggcatccgcaccgcgcgcgacctgcggccg
gaccttccgcaggtcgcggtcttcgacaccgccttccacaccacgatgccggagtccgcg
gcccgctacgcgatcgacgtggagaccgccgacgcgcaccggatccgccgctacggcttc
cacggcacctcgcacgcctacgtctcccgggagacggcgcggctgctgggccgggcgccc
gaggacgtgaacgtcatcgtgctgcacctgggcaacggggcgtcggcctcggcggtgcgg
ggcgggcggtgcgtggacacctccatggggctgacgcctttggaggggctcgtgatgggt
acgcgctcgggagacctggacccggccgtcatcttccatttgatgcgtgttggaggaatg
tccgccgacgagatcgacactctcctcaacaagaggagcggtctgatcgggttgtgcggt
gacaacgacatgcgggagatccgccgccgcgtcgacgccggcgacgaacgggcccggctg
gccttcgacatctacattcaccggctgaagaagtacatcggcgcctattacgccgttctc
gggcgcgtggacgcggtggtcttcaccgccggggtcggcgagaacgcggcggcggtgcgg
gaggccgccgtggcgggcctggaggggctgggcctggcggtcgacggcgaactgaacgcc
gggcggggcgacggggcgcggctggtgtcgcccccggacgcgcgggtggcggtggccgtc
gtaccgaccgacgaggaaatggagatcgcgacacagacctacgcgctggtaaaggaatcc
gggaatcctgcctga

DBGET integrated database retrieval system