KEGG   Streptomyces parvulus: Spa2297_22930Help
Entry
Spa2297_22930     CDS       T04685                                 

Definition
(GenBank) phosphate acetyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
spav  Streptomyces parvulus
Pathway
spav00430  Taurine and hypotaurine metabolism
spav00620  Pyruvate metabolism
spav00640  Propanoate metabolism
spav00680  Methane metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
spav01200  Carbon metabolism
Module
spav_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spa2297_22930
   00640 Propanoate metabolism
    Spa2297_22930
  09102 Energy metabolism
   00680 Methane metabolism
    Spa2297_22930
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Spa2297_22930
Enzymes [BR:spav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Spa2297_22930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB DRTGG AAA_26
Motif
Other DBs
NCBI-ProteinID: ANJ09578
UniProt: A0A191V3V1
LinkDB All DBs
Position
complement(5032438..5034531)
Genome map
AA seq 697 aa AA seqDB search
MTRSVYVTGIDRGDGRQVVELGVMELLTRQVDRVGVFRPLVHDGPDRLFELLRSRYRLSQ
DPATVYGMDYQEASALQAEQGTDELVSALVDRFHLVARDYDVVLVLGTDFADTQFPDELS
MNARLANEFGASVVPVVGGRKQTAESVLAETVNAFRAYDGLGCDVLAMVTNRVAREDRDE
IAERLANRLPVPCWVVPDEPALSAPTVSQIAHALGARVVLGDDSGLARDALDFVFGGAML
PNLLGALTPGCLVITPGDRADLVIGSLAAHSAGTPPIAGLLLTLDEVPGEGILTLAARLA
PGTPVLSVTGNSFPTAEQLFSLEGKLNASTPRKAETALGLFERYVDTAELSSRVSAPSSD
RVTPMMFEHKLLEQARSDLRRVVLPEGTEERVLHAAEVLLRRGVCELTLLGPVEQIRKKA
ADLGIDLEGAELTDPAVSELRDSFAEKYAELRAHKGVTVELAYDVVSDVNYFGTLMVQEG
FADGMVSGSVHSTAATIRPAFEIIKTKPDASIVSSVFFMCLADKVLAYGDCAVNPDPDAE
QLADIAIQSAATAARFGVEPRIAMLSYSTGTSGSGADVDKVREATELVRARRPDLRIEGP
IQYDAAVEPSVAATKLPDSEVAGQASVLIFPDLNTGNNTYKAVQRSAGAIAVGPVLQGLR
KPVNDLSRGALVQDIVNTVAITAIQAQQSPTEKVSDQ
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcagcgtgtacgtgaccggaatcgaccgcggggacggccgccaggtcgtcgag
ctgggggtcatggagcttctgacccggcaggtcgaccgggtcggcgtcttccgccccctg
gtgcacgacggacccgaccgcctcttcgagctgctgcgctcgcgctaccggctctcgcag
gacccggcgacggtctacggcatggactaccaggaggcgtccgccctccaggccgagcag
ggcaccgacgagctggtctccgcgctggtcgaccgcttccacctggtcgcccgggactac
gacgtcgtcctggtcctgggcaccgacttcgccgacacccagttcccggacgagctgtcg
atgaacgcccggctggccaacgagttcggcgcctcggtcgtgccggtcgtgggcggccgc
aagcagaccgccgagtcggtgctcgccgagaccgtcaacgccttccgcgcctacgacggg
ctgggctgcgacgtcctggcgatggtgaccaaccgggtcgcccgcgaggaccgggacgag
atcgccgagcggctggcgaaccggctgccggtgccgtgctgggtggtgccggacgagccc
gcgctgtccgcgccgaccgtctcccagatcgcgcacgcgcttggcgcccgggtcgtcctc
ggcgacgactcggggctcgcccgcgacgcgctggacttcgtcttcggcggggccatgctg
cccaacctgctgggcgcgctgacccccggctgcctggtcatcacgccgggcgaccgcgcc
gacctggtgatcggcagcctcgccgcgcacagcgcgggcacgccgccgatcgccggtctg
ctgctgaccctggacgaggtgcccggcgagggcatcctcaccctggccgcccgcctcgcc
cccggcactccggtgctgtcggtgaccggcaacagcttccccaccgccgagcagctgttc
tccctggagggcaagctcaacgcgtccaccccgcgcaaggcggagaccgccctcggcctg
ttcgagcggtacgtcgacaccgccgagctgagcagccgggtctccgccccgagcagcgac
cgcgtgacgccgatgatgttcgagcacaagctgctggagcaggcccgctccgacctgcgc
cgggtggtcctgccggagggcacggaggagcgggtgctgcacgccgcggaggtgctgctg
cgccggggcgtgtgcgagctgaccctgctcggcccggtcgagcagatccgcaagaaggcc
gccgacctcggcatcgacctggagggcgccgagctgaccgaccccgcggtctccgagctg
cgggactccttcgccgagaagtacgccgagctgcgggcccacaagggcgtgacggtggag
ctggcgtacgacgtggtgtcggacgtgaactacttcggcaccctgatggtgcaggaaggc
ttcgcggacggcatggtgtcgggttcggtgcactcgacggcggcgaccatccggcccgcc
ttcgagatcatcaagaccaagccggacgcctccatcgtctcctccgtcttcttcatgtgc
ctggccgacaaggtcctggcctacggcgactgcgcggtcaacccggaccccgacgcggag
cagctcgccgacatcgcgatccagtcggcggccacggcggcccggttcggcgtggagccg
cggatcgcgatgctgtcctactcgaccggcacctccggttccggcgccgacgtcgacaag
gtgcgcgaggccacggagctggtccgcgcgcgccgcccggacctcaggatcgaggggccg
atccagtacgacgccgcggtggagccgtcggtggccgcgaccaagctgccggactccgag
gtcgccgggcaggccagcgtgctgatcttccccgacctgaacaccggcaacaacacctac
aaggccgtgcagcgctcggccggcgccatcgccgtgggcccggtgctccagggtctgcgc
aagccggtcaacgacctgtcccggggcgcgctcgtgcaggacatcgtcaacaccgtcgcc
atcacggcgatccaggcccagcagtcccccaccgaaaaggtttccgaccagtga

DBGET integrated database retrieval system