KEGG   Streptomyces parvulus: Spa2297_26750Help
Entry
Spa2297_26750     CDS       T04685                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
spav  Streptomyces parvulus
Pathway
spav00250  Alanine, aspartate and glutamate metabolism
spav00410  beta-Alanine metabolism
spav00640  Propanoate metabolism
spav00650  Butanoate metabolism
spav01100  Metabolic pathways
spav01120  Microbial metabolism in diverse environments
Module
spav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Spa2297_26750
   00650 Butanoate metabolism
    Spa2297_26750
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spa2297_26750
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spa2297_26750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spav01007]
    Spa2297_26750
Enzymes [BR:spav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Spa2297_26750
Amino acid related enzymes [BR:spav01007]
 Aminotransferase (transaminase)
  Class III
   Spa2297_26750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANJ10256
UniProt: A0A191V5H0
LinkDB All DBs
Position
5910927..5912210
Genome map
AA seq 427 aa AA seqDB search
MTRDLLGRHRAVLPEWLALYYENPLEITHGEGRHVWDAAGNKYLDFFGGILTTMTAHALP
EVAKAVSEQAGRIIHSSTLYLNRPMVELAERIAHVSGIPDARVFFTTSGTEANDTALLLA
TAYRRSNTILAMRNSYHGRSFSSVGITGNSGWSPTSLSPLQTLYVHGGVRTRGPYAHLDD
RDFVAACVDDLRDLLGHTRAPAALIAEPIQGVGGFTSPPDGLYAAFREVLRERDVLWIAD
EVQTGWGRTGEHFWGWQAHAHNGPPDIVTFAKGIGNGMSVGGVVARAEIMNCLDANSIST
FGGTQITMAAALANLNHALEHDLQGNARRVGGLLLERLRAVAAQVPHVREVRGRGLMLGI
ELTRPGTDEAAPEAAATVLEEARAGGLLIGKGGGHNTSALRVAPPMSLTVAEAEEGAAIL
ERALRSI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgacctgctcggccgccaccgcgccgtcctgcccgagtggctcgccctgtac
tacgagaacccgctggagatcacgcacggcgagggccggcacgtctgggacgccgccggc
aacaagtacctcgacttcttcggcggcatcctcaccaccatgaccgcgcacgccctgccc
gaggtggccaaggcggtgagcgagcaggccgggcggatcatccactcctcgaccctctac
ctcaaccggcccatggtcgaactcgccgagcggatcgcccacgtgtccggcatccccgac
gcccgggtcttcttcaccacctccggcaccgaggccaacgacaccgccctgctgctcgcc
accgcgtaccggcgcagcaacacgatcctggcgatgcgcaacagctaccacggccgctcc
ttcagctcggtgggcatcaccggcaacagcggctggtccccgacctcgctgtccccgctc
cagaccctgtacgtgcacggcggcgtccgcacccgcggcccctacgcgcacctggacgac
cgcgacttcgtcgccgcctgcgtcgacgacctgcgcgacctcctcggccacacccgcgcc
cccgccgcgctgatcgccgagcccatccagggcgtcggcggcttcacctccccgcccgac
ggcctgtacgccgccttccgcgaggtgctgcgcgagcgggacgtcctctggatcgcggac
gaggtgcagaccggctggggccgcaccggcgagcacttctggggctggcaggcccacgcg
cacaacggtccgccggacatcgtgaccttcgccaagggcatcggcaacggcatgtccgtc
ggcggcgtcgtcgcccgcgccgagatcatgaactgcctggacgccaacagcatctccacc
ttcggcggcacccagatcaccatggcggcggccctcgccaacctcaaccacgccctggag
cacgacctccagggcaacgcccggcgcgtcggcggactcctcctcgaacggctgcgggcc
gtcgccgcccaagtcccgcacgtacgcgaggtccgcgggcgcgggctgatgctggggatc
gagctgacccggcccggcaccgacgaggcggcgcccgaggcggcggccaccgtgctggag
gaggcccgcgcgggcggcctgctcatcggcaagggcggcggccacaacaccagcgccctg
cgcgtcgccccgccgatgtccctcaccgtcgcggaggccgaggagggcgccgcgatcctc
gaacgcgccctgcggagcatctga

DBGET integrated database retrieval system