KEGG   Streptomyces parvulus: Spa2297_27885Help
Entry
Spa2297_27885     CDS       T04685                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
spav  Streptomyces parvulus
Pathway
spav00072  Synthesis and degradation of ketone bodies
spav00280  Valine, leucine and isoleucine degradation
spav00650  Butanoate metabolism
spav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Spa2297_27885
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Spa2297_27885
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_27885
Enzymes [BR:spav01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Spa2297_27885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ANJ10462
UniProt: A0A191V6C6
LinkDB All DBs
Position
complement(6194866..6195546)
Genome map
AA seq 226 aa AA seqDB search
MAWTRAEMAARAARELRDGQYVNLGIGLPTLIPNHLPEGVEVTLESENGILGTGRYPTEA
EVDPDLINAGKETVTVLPGAAFFDSALSFGMIRGGHIDVAVLGAMQVSAGGDLANWAVPG
KMITGIGGAMDLVHGARTVIVVMTHTAKDGSPKIVEECALPLTGRACVDRIVTDLGVLDV
TAEGLVLAETAPDVSVEEITARTGARLVAARGAGAAGQPETATEPT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcctggacgcgtgcggagatggcggcgcgcgccgcgcgggagctgcgggacggccag
tacgtcaacctcggcatcggcctgccgacgctgatccccaaccacctccccgagggcgtc
gaggtcaccctggagtcggagaacggcatcctcggcaccggccgctacccgaccgaggcc
gaggtggaccccgatctgatcaacgcgggcaaggagacggtgacggtgctgccgggtgcc
gccttcttcgactcggcgctgtccttcggcatgatccggggcgggcacatcgacgtcgcc
gtgctgggcgcgatgcaggtgtcggcgggcggcgacctggccaactgggccgtccccggc
aagatgatcaccgggatcggcggggcgatggacctggtccacggggcccgcaccgtgatc
gtggtgatgacccacaccgccaaggacggctcacccaagatcgtcgaggagtgcgcgctg
ccgctgaccggccgggcgtgcgtggaccggatcgtcaccgacctcggcgtcctggacgtc
acggccgagggcctggtcctggccgagaccgcgccggacgtgagcgtcgaggagatcacc
gccaggaccggtgcccggctcgtcgccgcacgcggggcgggagcggccgggcagccggag
accgctacggagccgacgtga

KEGG   Streptomyces parvulus: Spa2297_27890Help
Entry
Spa2297_27890     CDS       T04685                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
spav  Streptomyces parvulus
Pathway
spav00072  Synthesis and degradation of ketone bodies
spav00280  Valine, leucine and isoleucine degradation
spav00650  Butanoate metabolism
spav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Spa2297_27890
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Spa2297_27890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spa2297_27890
Enzymes [BR:spav01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Spa2297_27890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ANJ10463
UniProt: A0A191V6E0
LinkDB All DBs
Position
complement(6195546..6196301)
Genome map
AA seq 251 aa AA seqDB search
MDKVVATAGAAVADVPDGASLAVGGFGLSGVPNVLIEALQERGTGGLSVVSNNCGAMESG
LAVLLAAGRIARVTGSYIGANKEFARQYLAGELEVEMIPQGTLAERLRAGGAGIPAFYTP
AGVGTQVADGGLPWRYDGSGGVALASPPKEVREFDGTEYVLERGIRTDFALVRAARGDRH
GNLVFAKSSRNFNPLAAMAGRVTIAEVEELVEPGGIDPDAVHLPGIFVQRVVALTTEQAA
RKPVERRTVST
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggccacggccggtgccgcggtggccgacgtgccggacggcgcgtcg
ctcgcggtgggcggcttcgggctgagcggtgtgccgaacgtgctgatcgaggcgcttcag
gagcgcggcaccggcggtctgtcggtcgtctccaacaactgcggggcgatggagtccggg
ctcgcggtgctgctggccgcgggccggatcgcccgggtgaccgggtcctacatcggcgcc
aacaaggagttcgcgcgccagtacctcgccggggagctggaggtggagatgatcccgcag
ggcacgctggccgagcggctgcgggccggcggcgccgggatccccgccttctacacgccc
gccggagtcggcacccaggtggccgacggcggcctgccctggcgctacgacgggtccggc
ggggtcgcgctggcctccccgccgaaggaggtccgcgagttcgacgggaccgagtacgtg
ctggagcgcggcatccgcaccgacttcgcgctggtgcgggcggcccggggcgaccggcac
gggaacctggtgttcgcgaagtcctcccggaacttcaacccgctggccgcgatggccggg
cgggtgacgatcgcggaggtggaggagctggtggaacccggcggtatcgatccggacgcc
gtgcacctgcccggcatcttcgtgcagcgcgtggtggcgctgacgacggagcaggcggcg
cggaaaccggtcgagcggcggacggtgagcacctga

DBGET integrated database retrieval system