KEGG   Streptomyces parvulus: Spa2297_27910Help
Entry
Spa2297_27910     CDS       T04685                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
spav  Streptomyces parvulus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANJ10467
UniProt: A0A191V6D1
LinkDB All DBs
Position
complement(6199396..6200463)
Genome map
AA seq 355 aa AA seqDB search
MHLPVMPPVKPMLAKSVAKIPAGMHYEAKWDGFRAIVFRDGDEVELGSRTGKPLTRYFPE
LVAAVLERLPERCVVDGEIVIAREGHLDFDALTERIHPADSRVRTLAERTPASLVAFDLL
ALDDESLLDVALADRRALLVRALEGVSPPVHVAPATDDIEVARQWFEQYEGAGLDGVVAK
PLDGRYRQDERAMYKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDDRGVLQHVGVSAA
FTMKRRAELVEELEPLRMDDARGHPWAAWAEESAHEGARLPGAPSRWSGKKDLSWVPLRP
ERVVEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGGP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcccgtcatgccccccgtgaagccgatgctcgccaagtccgtggcgaagatc
ccggcggggatgcactacgaggccaagtgggacgggttccgggcgatcgtgttccgggac
ggggacgaggtcgagctgggcagccgcaccggcaagcccttgaccaggtattttcccgag
ctggtggcggcggtgctcgaacggttgccggagcggtgcgtggtcgacggggagatcgtg
atcgcgcgggaggggcatctggacttcgacgcgctgaccgagcggatccatccggcggac
tcgcgggtgcggacgctggccgagcggacgcccgcctccctggtcgccttcgacctgctg
gccctggacgacgagtcgctgctcgacgtggcgctggccgaccggcgggcgctgctggtg
cgggccctggaaggggtctcgccgcccgtgcacgtggctccggcgacggacgacatcgag
gtggcccggcagtggttcgagcagtacgagggcgcggggctcgacggggtcgtcgccaag
ccgctggacgggcgctaccggcaggacgagcgggcgatgtacaagatcaagcacgagcgc
acggccgacgtcgtcgtcgccggctaccggctgcacaagagcgggccggtggtcggttcg
ctcctgctcggcctgtacgacgaccggggtgtgctccagcacgtcggggtcagcgcggcc
ttcaccatgaagcgccgggccgagctggtggaggagctggagccgctgcgcatggacgac
gcccggggccatccgtgggccgcctgggccgaggagtcggcgcacgagggggcccggctg
ccgggtgccccgagccgctggtccgggaagaaggacctctcgtgggtgccgctgcggccc
gagcgggtcgtcgaggtggcctacgaccacatggagaacggggcgcgcttcaggcacacg
gcccgcttccgccgctggcgcccggaccgcaccccggagagctgcacctacgcccagctg
gaggagccggtccgctacgacctcgcggagatcctgggcggaccgtga

DBGET integrated database retrieval system