KEGG   Streptomyces parvulus: Spa2297_28605Help
Entry
Spa2297_28605     CDS       T04685                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
spav  Streptomyces parvulus
Pathway
spav00020  Citrate cycle (TCA cycle)
spav00480  Glutathione metabolism
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
spav01120  Microbial metabolism in diverse environments
spav01130  Biosynthesis of antibiotics
spav01200  Carbon metabolism
spav01210  2-Oxocarboxylic acid metabolism
spav01230  Biosynthesis of amino acids
Module
spav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spav_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spa2297_28605
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Spa2297_28605
Enzymes [BR:spav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Spa2297_28605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: ANJ10591
UniProt: A0A191V6E4
LinkDB All DBs
Position
complement(6357296..6359515)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIRAYASQAGVAVETRDISLAGRIISLFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAIAELQGQGYALPAYPDDPKTDEER
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKNHPHRMGAWTGESKTNVATMGEND
FRSTEKSVVVAEDGALRIELVGDDGTTTVLRESVPVKKDEVLDASVLRVAALREFLTAQV
ARAKAEGILYSVHLKATMMKVSDPIIFGHVVRAFFPKTFAQFGDKLAAAGLTPNDGLGGI
YKGLESLPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGADGQEHDALAVIPDSSYAGVYQAVIDDCRAHGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRLVGADGEPVLEQTVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIAKVKQYLPEHDTEGLDIKILSPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKEDYLRWD
SLGEFFALVPSLEQYAETTGNTKARVLADALDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAKQTDDADLAKAFAPLAETLTAAEQKIVDELNAVQGKPAEIGGYYQPDPAK
AAAVMRPSATWNEALASLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacacacactgacgaggccccggccctggcgacgtat
tcgttcctgccggtgatccgggcgtacgcctcgcaggcgggtgtcgccgtcgagacccgc
gacatctcgctggccggccgcatcatctccctcttcccggagtacctcaccgaggaccag
cgcatcccggacgccctcgcggaactcggtgagctggccaagacgcccgccgcgaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggccgcgatcgccgagctg
cagggccagggctacgcgctgccggcctacccggacgacccgaagaccgacgaggagcgc
gacgtccgcgcccgctacgacaaggtcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgccccggcctcggtgaagaactacgccaagaaccacccgcac
cgcatgggcgcctggaccggcgagtcgaagacgaacgtcgccacgatgggcgagaacgac
ttccgctccaccgagaagtccgtggtggtcgccgaggacggcgcgctgcgcatcgagctg
gtcggcgacgacggcaccaccacggtgctgcgcgagtcggtacccgtgaagaaggacgag
gtcctcgacgcctccgtgctgcgcgtcgccgcgctgcgcgagttcctgaccgcgcaggtc
gcccgcgccaaggccgagggcatcctgtactcggtgcacctgaaggccacgatgatgaag
gtgtccgacccgatcatcttcggccacgtggtccgcgccttcttcccgaagaccttcgcg
cagttcggcgacaagctcgccgcggccggcctcaccccgaacgacggcctcggcggcatc
tacaagggcctggagtccctgcccgagggcgccgagatcaaggcctccttcgacgccgag
ctggccgagggccccgagctggccatggtcgactccgacaagggcatcaccaacctgcac
gtgccctcggacgtcatcatcgacgcctccatgcccgccatgatccgcacctccggccac
atgtggggcgcggacggccaggagcacgacgccctcgccgtcatcccggactcctcctac
gccggcgtgtaccaggcggtcatcgacgactgccgcgcccacggcgcctacgacccctcc
accatgggctcggtcccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccaccacgggcacggtccgcctggtcggcgccgacggc
gagcccgtgctggagcagacggtctccgccggcgacatcttccgcgcctgccagaccaag
gacgccccgatccgggactgggtcaagctggccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagggccgcgcgcacgacgccaacctgatcgccaaggtg
aagcagtacctgccggagcacgacaccgagggcctggacatcaagatcctctccccggtc
gaggcgaccaagctgtcggtggagcgcatccgccggggcgagaacaccatctcggtcacc
ggcaacgtgctgcgcgactacctgaccgacctcttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctcttcgagaccggcgcc
ggcggctcggccccgaagcacgtgcagcagctggtcaaggaggactacctgcgctgggac
tccctcggcgagttcttcgccctggtgccgtccctggagcagtacgcggagacgaccggc
aacaccaaggcccgggtcctcgccgacgccctcgaccgcgcgacggcgaccttcctcaac
gaggacaagtcgccgacccgccgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggccaagcagaccgacgacgcggacctggccaag
gccttcgccccgctcgccgagacgctcaccgccgccgagcagaagatcgtcgacgagctg
aacgccgtccagggcaagcccgccgagatcggcggctactaccagcccgacccggccaag
gccgccgcggtcatgcgcccctcggccacctggaacgaggcgctggcgtccctcgcctga

DBGET integrated database retrieval system