KEGG   Streptomyces parvulus: Spa2297_32260Help
Entry
Spa2297_32260     CDS       T04685                                 

Definition
(GenBank) hypothetical protein
Organism
spav  Streptomyces parvulus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ANJ11804
UniProt: A0A191V9V2
LinkDB All DBs
Position
pSPA1:complement(15534..20675)
Genome map
AA seq 1713 aa AA seqDB search
MHTTFIETLRRRAASTPDRLALEFELSETETRTLTYAELDRGARTVAAQIQQYAGRGERV
LLLHQPGPDYVTAFFGCLYSGAIAVPLYPPLGTNGLERLRSVVADSGAALALLDTATLAA
IGEGRDRLDPAAPLTWVTTDDAPTAPGDWQDPHVSPDDLAFLQYTSGSTGTPKGVMLSHA
NLVHNSATIAGALGLDEDSRAVSWLPPYHDMGLIGGILQPVHTGFPCTLLSPLTFLHDPM
RWLRALSRTRATVTAAPDFAYAEAVRRATPGDHDDLDLSALRHALVGAEPVRRTTMDAFT
SAFRDNGFGREAFYPCYGLAEATLFVTGRADPSADPTTLRLRRTDMEEGRAVVAAPDEPA
VELTGCGWAHQQDLVLIADPATGEPLPPGAVGEIWVSGPTVAHGYWNQPRRTADSFAGVA
RDHRGRTFLRTGDLGFQHDRELYVTGRIKDLIIVRGRNLYPPDIEMTAERAHPLLYPGRG
AALAVDDGTSEQVVLVHEVVRGFKEEDAPLVGTAVREAVAAEHGLALADVVLVRTGKIPR
TSSGKIRRSECRARWLAGTLRPLGTTGPAEAAAPVPAELAEIVAAALDTSPTALAQDAPL
VGQGLDSLRASRLRSALLEWRGVDVPTTRLLSGLTLLDLAGLPAGRSAPPAGNPEPVGIT
PDQERIWLLDQMGAGDAYHVAGGLRLTGPLDETLLERSLTSLFEQVPPLRTAFPTAADGT
PGLSVRPTADVFRLPRKDLSASGEDGVARELAALAAAPFDLASGPLVRLHLLRQGPADWI
LAIAAHHAVLDGWSMGLILGRLGDAYRDGGTVTPLPATIPARTPWTEETLTAWRERLDGA
QPLELPTDHPVPATPTWRGASLPVRIPTDLADRLRTVATARQATPFMVLMAAFGVLLGRW
SGQHDVVVGTVAAGRDRPGADTAVGMFADTLPLRVRSGATDFATVVDEVRTQCLAAYGPD
RPPYDEIVRALTERPADGRAPLVRALLAFQNLPLSPWEAHGVRAEPFELPAPGAQFELSV
HLAPQSDGSLVGHAVYAADLFHEQTVAGLLAGLPVLLDAALTDPAAPVAALPALAPAEGE
RIARTVADGGPARLGDGLVHEIVERLARSAPRAAAVVWDEGSLTYGELDTRARRLAARLR
ELGVRGDEPVAVCLPRSPELIVAVYAVLLAGAAYLPLDTAHPSARLARQLDSSGARLLIG
SVPGLAPPEGILPVDPHEAGADPSDLPRVHPDHLANVLFTSGSTGEPKAVMTSHAALVNQ
LVWFRDAYGLDASEAVLHKTPVSFDVAGLELLGPLVAGASVVLTRPEGHRDPHYLAHLIA
RHSVTTCHFVPSMLQAFLEEPDALHAARTLRRIVCIGEELAPALAARCAEILPGVEVHNL
YGPTEAAIDVTAQAVTPEAARHSRIPIGRAIAGTRLYVLDSSGGIAPPLVPGELHIGGIA
PARGYLNRPGLTAERFVPDPYHPGARLYRTGDRARMRPDGTFEYLGRLDRQLKIRGQRVE
PGEIEAALNRHPLVRASVVEARPDTSGRARLLAWAVPAGTERPTPAQLRHHLEQTLPSGL
VPDAMTLLEELPVGPHGKLDRSALPDPDPAADIPQESIAPRDPVERRMAAIWSEVLGIPV
PSVTADFFRLGGHSLMATRVAMRVRDTFGVALSTGELLSGTLTIERLAELVQSRQLAEAG
GSDVDDVLGWLSGLSDDEVTAMLARETDGENRP
NT seq 5142 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgaccttcatcgagacgctccgccggcgcgccgcgagcacccccgaccgcctg
gccctggagttcgaactctccgagaccgagacgcggacgctcacctacgccgaactcgac
cggggcgcacggacggtggccgcccagatccagcagtacgccggccggggcgagcgggtc
ctgctgctgcaccagcccggccccgactacgtgacggccttcttcggctgcctgtactcg
ggtgcgatcgccgtgcccctctacccgccgctcgggacgaacggcctcgaacgcctgagg
tccgtcgtcgccgactccggcgcggccctcgccctcctcgacaccgccaccctcgccgcc
atcggcgaaggccgtgaccggctcgaccccgcggcccccctcacctgggtcaccaccgac
gacgcccccaccgcccccggggactggcaggacccgcacgtctccccggacgacctggca
ttcctccagtacacgtcgggctccaccggcacacccaagggcgtcatgctcagccacgcc
aacctcgtgcacaactccgcgacgatcgccggggcactgggcctcgacgaggacagccgc
gccgtgagctggctgccgccctaccacgacatgggactgatcggcggcatcctgcaaccg
gtgcacaccggcttcccctgcacactgctctcgccgctgaccttcctccacgacccgatg
cgctggctgcgcgcgctcagccgcacccgggccaccgtcaccgccgccccggacttcgcc
tacgccgaagcggtgcgccgggccacaccgggggaccacgacgacctcgacctgtccgcg
ctgcggcacgccctggtcggcgcggagccggtacgccgcaccacgatggacgccttcacc
tcggccttccgcgacaacggcttcggccgcgaggcgttctacccgtgctacggcctcgcc
gaggccaccttgttcgtcaccggcagggccgacccctcggccgaccccaccaccctgcgc
ctgcgccggacggacatggaggagggccgggccgtggtggccgcgcccgacgagcccgcc
gtcgaactgaccggctgcggatgggcacaccagcaggacctcgtgctgatcgccgatccc
gccaccggtgaaccgctgccgcccggcgccgtcggcgagatctgggtcagcggcccgacc
gtggcccacggctactggaaccagccccggcgcacggccgactccttcgcgggcgtggcc
cgtgaccacaggggacgcaccttcctgcgcaccggcgacctcggcttccagcacgaccgg
gagctgtacgtcaccggccggatcaaggacctgatcatcgtgcgcggccgcaacctctac
ccgccggacatcgagatgacggccgagcgcgcccaccccctcctgtacccgggccgcggc
gcggccctggccgtcgacgacggaacctcggagcaggtcgtgctcgtccacgaagtggtc
cgcggcttcaaggaagaggacgcgccactcgtcggcaccgccgtgcgcgaggccgtggcg
gccgagcacgggctcgcgctcgcggacgtcgtactggtgcggaccggcaagatcccccgc
accagcagcggcaagatcagacgctcggagtgccgtgcgcgctggctcgccggaacgctg
cgccccctgggcacgaccggaccggccgaggcggccgcgccggttcccgccgagctggcg
gagatcgtcgccgccgccctggacaccagcccgaccgcgctggcccaggacgcgccactg
gtcggacaggggctcgactcgctgcgcgcctcccgcctcagatcggccctcctggagtgg
cgcggtgtcgacgtccccaccacccggctcctgagcggactcaccctcctggacctcgcc
ggactccccgccggccgctccgcaccacccgcgggcaacccggagcccgtcggcatcact
cccgaccaggagcggatctggctgctcgaccagatgggcgcgggcgacgcctaccacgtc
gccgggggactccggctcaccggcccgctcgacgagacgttgctggagcgctctctcacc
agcctgttcgagcaagtcccgccgctgcgcaccgcgttcccgaccgcggcggacggaacg
ccgggcctgtccgtccggcccaccgcggacgtgttccggctgccccgcaaggacctcagc
gcatccggcgaggacggcgtcgcccgggaactggccgcgctggcagccgcacccttcgac
ctcgcctccggccccctggtacgcctgcacctgctccggcagggacctgcggactggatc
ctcgcgatcgccgcccaccacgccgtcctcgacggctggtcgatgggcctgatcctcggc
aggctgggcgacgcctaccgcgacggcggcacggtcacgccgctgcccgcgacgatcccg
gcccgcacgccgtggaccgaggaaaccctcaccgcatggcgcgagcggctcgacggggcc
cagcccctggaactgccaaccgaccaccccgttcccgccacgcccacgtggcgcggcgca
tccctgcccgtacggatccccaccgacctcgccgaccggctgcggaccgtcgccaccgca
cgtcaagccactccgttcatggtcctcatggccgcattcggcgtgctgctcggccgatgg
agcggccagcacgacgtggtggtcggcaccgtggccgcgggacgcgaccggcccggcgcc
gacacggccgtcggcatgttcgccgacacactgccgctgcgcgtgcgcagcggcgccacc
gacttcgccaccgtcgtcgacgaggtgcggacccagtgcctggcggcctacggccccgac
aggcccccctacgacgagatcgtccgcgccctcaccgagcggcccgccgacggccgtgcc
ccgctcgtgcgggccctgctcgccttccagaacctcccactcagcccctgggaggcccac
ggagtccgcgccgagcccttcgaactgcccgcacccggagcccagttcgagctgtccgtg
cacctcgccccccagagcgacggctcgctcgtcggccacgccgtctacgcggccgacctg
ttccacgagcagaccgtcgccggcctgctggccggactgcccgtactgctcgacgcggcg
ctcaccgacccggccgccccggtcgccgcactgccggcgctggcacccgctgagggcgag
cggatcgcccgcaccgtcgcggacggaggcccggcccggctcggcgacgggctggtccac
gagatcgtcgaacgcctcgcacgttcggccccccgtgcggcggccgtggtctgggacgag
ggttcgctcacctacggcgaactggacacccgggcccgccggctggccgcccggctgcgc
gaactcggcgtgcgcggcgacgaaccggtcgcggtctgcctgccgcgttcccccgagctg
atcgtcgccgtgtacgccgtcctgctggccggagccgcctacctccccctggacaccgcc
cacccctcggcccgcctcgcccggcagctcgacagctcaggggcgcgactgctcatcggc
tccgtaccgggcctcgccccgcccgagggcatcctgccggtcgacccccacgaggccggc
gccgacccgtccgacctcccgcgggtgcaccccgaccacctcgccaacgtgctgttcacc
tccggctcgacgggcgaacccaaggccgtgatgaccagccacgccgccctcgtcaaccag
ctcgtctggttccgcgacgcctacggcctcgacgcgtcggaagccgtcctgcacaagacc
cccgtcagcttcgacgtcgccggactggaactgctcggaccgctcgtcgccggagcctcg
gtcgtcctcaccaggccggaaggacaccgcgacccccactacctcgcccacctgatcgcc
cggcactccgtcaccacctgccacttcgtcccgtcgatgctgcaggccttcctcgaagaa
cccgacgccctgcacgccgcgcggaccctgcgccgcatcgtgtgcatcggggaggaactg
gcgccggcactggccgcacgctgcgccgagatcctgcccggcgtggaagtgcacaacctg
tacggccccacggaggcggcgatcgacgtcaccgcacaggccgtcacgcccgaagcggcc
cggcacagccgtatccccatcggccgcgccatcgccggcacccggctctacgtcctcgac
tcctcgggcggcatcgccccaccgctggtccccggcgaactccacatcggcggcatcgcc
cccgcccgcggctacctcaaccgccccggcctgaccgccgaacgcttcgtgcccgacccg
taccaccccggcgcccgcctgtaccggacgggcgaccgcgcccggatgcgtcccgacggc
accttcgagtacctgggacgactcgaccggcagctcaagatccgcggccagcgcgtggag
cccggcgagatcgaggccgccctgaaccggcacccgctcgtgcgggcctccgtcgtggag
gcacgccccgacacctcgggccgggcgcggctactggcctgggccgtcccggcgggcacc
gagcgacccaccccggcccagctgcgccaccacctcgaacagaccctgccctcagggctc
gtcccggacgcgatgaccctgctcgaggaactccccgtgggcccgcacggcaaactcgac
cgctcggcgctgcccgaccccgacccggccgcggacatcccgcaggagtcgatcgcaccc
cgcgaccccgtggagcgcaggatggccgccatctggagcgaggtgctcggcatccccgta
ccctccgtcacggccgacttcttccgtctcggcggccactccctcatggccacccgcgtc
gccatgcgcgtacgcgacacgttcggagtggccctgtccaccggcgaactgctcagcggc
accctgaccatcgagcggctggccgaactggtgcagagcagacagctcgccgaggcgggc
ggcagcgacgtcgacgacgtcctcggctggctctcgggcctttccgacgacgaggtcacc
gcgatgctcgccagggagacggacggcgagaaccgcccctga

DBGET integrated database retrieval system