KEGG   Streptomyces parvulus: Spa2297_32850
Entry
Spa2297_32850     CDS       T04685                                 

Definition
(GenBank) erythromycin biosynthesis sensory transduction protein eryC1
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
spav  Streptomyces parvulus
Pathway
spav00523  Polyketide sugar unit biosynthesis
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Spa2297_32850
Enzymes [BR:spav01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     Spa2297_32850
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase HisG_C
Other DBs
NCBI-ProteinID: ANJ12174
UniProt: A0A191VAX4
LinkDB
Position
pSPA1:complement(210082..211188)
AA seq 368 aa
MAFHDLRDLHALDGVQERVDAAVLRVARSGRYLLGPELAAFEEEFARYCENEHCVGVGSG
LDALELALRALDVGPGDEVIVPAHTYIATWLAVSAVGARPVPVEPEADSYLMDPERLADA
CTSRTRAVMPVHPYGHPADLDAIDAVAAARGIPVVEDAAQAHGARYRGRRAGSRYVAAFS
FYPGKNLGALGDAGAVVTSDARLAERVRLLRNYGSRVKYRHEVPGTNSRLDEIQAAALRV
KLTCLDGWNARRAEVAARYTEGLAGLPGLDVPTVRPWAEPVWHQYVVRTARRAALVSALE
AAGVETLVHYPVAVHRSEAYAGAVHGPLPRSERLADEVLSLPMGPQLTAQDVTAVIAAVR
EATETIHD
NT seq 1107 nt   +upstreamnt  +downstreamnt
gtggccttccacgacctgcgggacctgcacgcgctggacggtgtgcaggagcgggtggac
gcggccgtgctgcgggtggcccgctcgggccgctatctgctggggcccgaactcgcggcg
ttcgaggaggagttcgcccgctactgcgagaacgagcactgtgtcggcgtgggcagcggt
ctggacgcgctggagctggccctgcgggccctggacgtgggtccgggggacgaggtgatc
gtgcccgcgcacacctacatcgccacgtggctggcggtgtcggcggtgggggcgcggccg
gtcccggtggagcccgaggcggactcgtacctgatggatccggagcggctggccgacgcc
tgcacctcgcggacgcgggccgtcatgccggtgcatccctacgggcatccggcggacctc
gacgcgatcgacgccgtggccgccgcccggggtattccggtggtcgaggacgcggcgcag
gcgcacggggcgcgctaccggggccggcgggccggttcgcggtacgtggccgcgttcagc
ttctacccgggcaagaacctgggggcgctgggtgacgcgggcgcggtggtgacgtcggac
gcgcggctcgcggagcgggtacggctgctgcgcaactacgggtcgcgggtcaagtaccgg
cacgaggtgcccggcacgaactcgcggctggacgagatccaggctgccgcgctgcgggtg
aagctgacctgcctggacgggtggaacgcccgccgggccgaggtcgcggcccgctacacc
gagggtctggcggggctgccggggctggacgtgcccacggtgcggccgtgggccgagccg
gtgtggcatcagtacgtggtgcgcaccgcgcgtcgtgccgctctggtgtccgcgctggag
gcggccggggtggagacgctggtgcactatccggtggccgtgcaccgctccgaggcctac
gcgggagcggtgcacgggccgctgccccgcagcgagcgcctggccgacgaggtgctgagc
ctgcccatgggcccgcaactgaccgcgcaggacgtcacggccgtcatcgcggcggtccgc
gaggcgacggagaccattcatgattga

DBGET integrated database retrieval system