KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy0836Help
Entry
M28_Spy0836       CDS       T00263                                 

Gene name
tdk2
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00240  Pyrimidine metabolism
spb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M28_Spy0836 (tdk2)
Enzymes [BR:spb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M28_Spy0836 (tdk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AAX71949
UniProt: Q48TL1
LinkDB All DBs
Position
854928..855497
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAI
PISNDMDIFTFIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPEI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggcaaacctgttgtcattatgacaagtgctctt
gatacacgtgatggttttggcatcgtctcaagccgtattggtatgcgacgagaagctatc
cccatttcaaatgacatggatattttcacatttattgcccaattggaggaaaaaccttat
tgtgtcctgattgacgaaagccaatttttaagcaagcaaaatgtttatgatttggcgcgt
gtggtggatgagctaaatgttcctgtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagagatttaa

DBGET integrated database retrieval system