KEGG   Streptococcus pyogenes MGAS6180 (serotype M28): M28_Spy1502Help
Entry
M28_Spy1502       CDS       T00263                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spb  Streptococcus pyogenes MGAS6180 (serotype M28)
Pathway
spb00220  Arginine biosynthesis
spb00250  Alanine, aspartate and glutamate metabolism
spb00290  Valine, leucine and isoleucine biosynthesis
spb01100  Metabolic pathways
spb01110  Biosynthesis of secondary metabolites
spb01130  Biosynthesis of antibiotics
spb01210  2-Oxocarboxylic acid metabolism
spb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M28_Spy1502
   00290 Valine, leucine and isoleucine biosynthesis
    M28_Spy1502
   00220 Arginine biosynthesis
    M28_Spy1502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spb01007]
    M28_Spy1502
Enzymes [BR:spb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     M28_Spy1502
    2.6.1.66  valine---pyruvate transaminase
     M28_Spy1502
Amino acid related enzymes [BR:spb01007]
 Aminotransferase (transaminase)
  Class I
   M28_Spy1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AAX72612
UniProt: Q48RP8
LinkDB All DBs
Position
complement(1494638..1495888)
Genome map
AA seq 416 aa AA seqDB search
MVYNMEYEVYETMKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGF
EAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELI
SISLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSR
TKAIVVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAP
DVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQT
SLGGHQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDD
EEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggtttataatatggaatacgaggtgtatgagactatgaaaattattgaaaaatcatca
aaattagaacatgttgcctatgatattcgagggcctgttttggatgaagctaatcgcatg
attgcgagtggtgaaaaaattctgcgtttaaatactggcaatcctgctgcttttggtttt
gaagcaccagatgaagtgattcgtgatttaattgtcaacgcgaggctaagtgagggctat
tctgacagtaaagggattttttcagcgcgtaaggctatcatgcagtattgccaactcaag
ggcttcccagatgttgacattgaagatatttatttgggaaatggcgtgtcagagttgata
tccatatcccttcaagctttgctagataatggcgatgaagttttagtaccaatgccggat
tatcctttatggacggcttgtgtgagtcttggtggaggaaaagcggtccattatctttgt
gatgaagaagctggttggtatcctgatattgctgatatcaaatcaaaaatcacgagtcgc
accaaagctattgtggtcatcaatcctaataacccaacaggagccctttatcctaaggag
attttagaagacatcgttgctttggcaagagaacaccagctgattatttttgccgatgaa
atctatgatcgtttggtgatggatggtaaagagcatattgctattgcaagtttggcacct
gatgttttttgtgtatctatgaatggtctttccaaatctcatcgtattgctggttttcgt
gttggatggatggtcttatcaggtcctaaagaccatgttaaaggttacattgaagggtta
aacatgcttgccaatatgcggttatgctccaatgttttagcccaacaagttgttcaaact
tccttaggaggtcatcaatcagttgatgcactgttactgccaggagggcgtatttttgag
caacgtaattttatttatgaagctattaatgctatccctggcttatcggcagttaaacct
gaagcaggtctttatttatttccgaaaattgatcgtcagatgtatcgtattgatgatgat
gaagaatttgtcttacagttattaaagcaagaaaaagtgatgttggtacatggacgtggt
tttaactggaaagatccagatcacttccgtattgtttacctaccaagtgtagaagaatta
gaagatgtccaagaaaagattacacgtgtcttataccagtatagacgttaa

DBGET integrated database retrieval system