KEGG   Shewanella putrefaciens CN-32: Sputcn32_0013Help
Entry
Sputcn32_0013     CDS       T00513                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00071  Fatty acid degradation
spc00280  Valine, leucine and isoleucine degradation
spc00281  Geraniol degradation
spc00310  Lysine degradation
spc00362  Benzoate degradation
spc00380  Tryptophan metabolism
spc00410  beta-Alanine metabolism
spc00640  Propanoate metabolism
spc00650  Butanoate metabolism
spc00903  Limonene and pinene degradation
spc00930  Caprolactam degradation
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01120  Microbial metabolism in diverse environments
spc01130  Biosynthesis of antibiotics
spc01200  Carbon metabolism
spc01212  Fatty acid metabolism
Module
spc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sputcn32_0013
   00650 Butanoate metabolism
    Sputcn32_0013
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sputcn32_0013
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sputcn32_0013
   00310 Lysine degradation
    Sputcn32_0013
   00380 Tryptophan metabolism
    Sputcn32_0013
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sputcn32_0013
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sputcn32_0013
   00281 Geraniol degradation
    Sputcn32_0013
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sputcn32_0013
   00930 Caprolactam degradation
    Sputcn32_0013
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sputcn32_0013
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sputcn32_0013
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sputcn32_0013
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Sputcn32_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DUF957
Motif
Other DBs
NCBI-ProteinID: ABP73749
UniProt: A4Y1B6
LinkDB All DBs
Position
complement(17094..19244)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDSIKQNSNIKALVLTSS
KDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWISTGNDQRAEDALK
VGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGMV
FAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQLVK
GKAKKAGKLAKEVKNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAAKLL
SAQVARGRSTPEKMAKVLNNITPSLDYAALKHSDVVVEAVVEHPKIKAQVLAEVEGYVSE
DAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSRGKP
KKDVDPTSYGLLKDAFGELKTFEADDIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTKATNNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaagttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgacagagaaaccctcgcttcgctcgat
gccgcattagacagcatcaagcaaaattccaatatcaaagcgttagtgctgacctccagt
aaagatacctttattgtgggtgccgacattaccgaatttttaggcctatttgcacaagat
gatgctgtactgctctcttgggttgaacaagccaacgctgtcttcaacaaactcgaagac
ttacctttcccaaccgcatctgcaatcaaaggctttgccttaggtggcggctgtgaaacc
attctggcaacggattttcgtatcgcagataccacagccaaaatcggtttacctgaaact
aaactcggcatcatcccaggctttggcggcacagttcgtctgccacgtgtaattggtgca
gataacgcacttgaatggatctccacaggtaacgaccaacgcgctgaagatgcactgaaa
gtcggtgctgtggatgctgtggttgcgccagaagcattagaagcggctgcgattcaaatg
ctcaaagatgctgttgcagaaaagctggattggcaagcgcgtcgtaaccgtaagctgtct
gccctaacgctgcccaaacttgaagctatgatgtcattcaccacagctaaaggcatggta
tttgctgttgcgggtaaacactacccagcaccaatggccgcagtaagcgtgattgagcaa
gcatcgactaaaggtcgtgctgaagcattacaaatcgaacatcaagcctttatcaagctg
gctaaaaccgacgttgctaaggcacttataggtatcttccttaatgatcaactcgttaaa
ggcaaagcgaaaaaagcgggtaagttagccaaagaagtgaaaaacgctgccgtattaggt
gctggcattatgggcggcggcatcgcctaccaaagcgccagcaaaggcacaccgattgtc
atgaaagacattgcccagccagcattagatttaggcctcaatgaagccgccaaactgcta
tcggcgcaagttgctcgtggccgttcaacgccagaaaaaatggccaaagtgctgaacaac
atcacgccttcattagattatgctgcgctcaaacacagtgatgtcgtcgttgaagccgtt
gttgaacatccaaaaattaaagcacaggttttagccgaagttgaaggttatgtgagtgaa
gatgcgattatcgcgtcaaacacctcaacgatttcaatcaacttgctcgctaagagcatg
aagaaacctgagcgtttctgcggtatgcatttcttcaacccagtgcacaaaatgccgttg
gtagaagttatccgtggcgagcacagctctgaagaaaccatcgcctctgttgtggcttac
gccagcaaaatgggcaaaaccccaatcgtggttaatgattgcccaggcttcttcgttaac
cgcgtactcttcccttactttgcaggctttaacggcctacttgccgaaggtggcgacttt
gctgcaatcgacaaagttatggaaaaacaatttggttggccaatgggcccagcttaccta
ctcgacgtagtgggtttagacacaggtcaccatgcccaagcagtaatggctgaaggtttc
cctgatcgtatgggtaaatctggtaccgacgcgattgatgtgatgtttgagaacaagcgc
cttggccagaaaaatggcaaaggtttctatgtctattcagttgatagccgtggcaaaccg
aagaaagatgtcgatcctacgagctacggcctattgaaagatgcctttggcgagttaaaa
acctttgaagccgatgacattattgcccgtactatgatccctatgatcatagaaaccgtg
cgctgtttagaagaaggcattgtcgcatcacctgccgaagcggatatgggcctggtttat
ggcttaggtttcccgccattcagaggaggcgtgttccgttacttggataccatgggtgtc
gcaaactttgtggccttagcagacaaatatgctcacttgggcggtctgtatcaagtcaca
gatgcgatgcgtacaaaagccaccaataatggtagctactaccaagcctaa

DBGET integrated database retrieval system