KEGG   Shewanella putrefaciens CN-32: Sputcn32_0895Help
Entry
Sputcn32_0895     CDS       T00513                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spc  Shewanella putrefaciens CN-32
Brite
KEGG Orthology (KO) [BR:spc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sputcn32_0895
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sputcn32_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO Glutaredoxin NAD_binding_7 Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABP74624
UniProt: A4Y3U1
LinkDB All DBs
Position
complement(996227..997798)
Genome map
AA seq 523 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLANDIVSLSSLVSLKEIQGERT
PAMTVINPELNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDDLIEQIRNLPGKYAFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQEEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTNAASRKADEINEKAPFEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVSLNTDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDKTLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTIDLTPRGEIIVDERGQTSVPGIFAA
GDVTNSPFKQIIIAMGSGATASLGAFDYLIRHSDEETAATKAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttgaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtctgcagatgagagcaaaaagtctcaagaattaaaaagtttagct
aatgacattgtcagcctatcttctctggtgagcctgaaagaaattcagggcgaacgcacc
ccggcgatgacagtgataaacccagaacttaatacgcaaatcagctttgctggtctgcct
atgggtcacgaatttacgtcactcgtgctggccttactgcacacgggtggacacccaatc
aaactgagcgatgatctcatcgagcagatccgtaatttgccgggcaaatatgcctttgaa
acttatgtatcactgacctgccaaaactgcccagacgtagttcaggcactgaatatgatg
gcggccattaacccgaatatcaccaacgtgatgattgatggtgccctattccaagaagaa
gtagcgagccgtaatattatggccgtaccttctgtctacttaaatggcgaagtgtttgcc
gcaggtcgcatcagcataggtgagattttaaataaactggacacaaatgcagccagccgc
aaggccgatgaaattaatgaaaaagcccccttcgaagtcttagtcgttggcggcggccca
gcaggcgcagcagcagccatttatgcagcacgtaaaggacttcgcactggtattgttgcc
gacaagtttggcggccaagtcgctgaaaccgtcggtatcgagaactttatctcggtcaaa
gcgaccgaaggtccaaaactggtagccaaccttgaagcccatgtgcgtgactatgaagtc
gatatcatggacaaccaaaaggccgtatcgctaaacacagatggcttgttcgagcttgaa
ctggcaagtggtgctaagctacgtagccgcactgtattgttagccacaggtgcgcgctgg
cgtgagatgaacgtgcccggcgagaaagaataccgcggcaaaggcgtagcatactgccca
cattgcgatggcccgttatttaagggtaagcgtgtggcggtgatcggcggcggtaactca
ggtatcgaggcggctatcgaccttgcgaacatagtagaacatgtaacagtactggaattt
gataaaaccctgcgcgccgacgatgtgctgcaacgtaaagccgcatctatgggtaacatt
aaaatcattacccaagcgatgaccactgaagtgacgggcgatggcactcgggtgaatggc
ctaaactacaccgaccgcgcaacgggtgaaagccaccatatcgcgctggcagggatcttc
gtgcagattgggctagtacccaatgcggaatggttgaagggcactatcgatttaacccca
aggggcgaaatcatagtcgatgagcgcggccaaacctcagtcccaggtatttttgccgca
ggtgatgtcactaactcaccgtttaagcaaattattatcgccatgggcagcggcgcgacc
gcatcactgggggcatttgattacttaattcgccacagcgatgaagagaccgccgcgacc
aaagcagcttaa

DBGET integrated database retrieval system