KEGG   Shewanella putrefaciens CN-32: Sputcn32_1469Help
Entry
Sputcn32_1469     CDS       T00513                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00250  Alanine, aspartate and glutamate metabolism
spc00410  beta-Alanine metabolism
spc00430  Taurine and hypotaurine metabolism
spc00650  Butanoate metabolism
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01120  Microbial metabolism in diverse environments
spc02024  Quorum sensing
Module
spc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sputcn32_1469
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sputcn32_1469
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sputcn32_1469
   00430 Taurine and hypotaurine metabolism
    Sputcn32_1469
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sputcn32_1469
Enzymes [BR:spc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sputcn32_1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABP75194
UniProt: A4Y5G1
LinkDB All DBs
Position
complement(1670175..1671824)
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLMRIFTVPEDAESTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFKIPTQPRFVSDYTDEIMQNLVAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYAQNTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVTREGLLKALRYYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDSHNKVDIAKMRKAALELARKNIKVLAIVGVAGTTETGNVDPLIELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGLDGYEILINNSIEKARYFAE
QIKAHRDFELVTEPELCLLTYRYVPAKVQAAMQVAIEQGDTAKLARFNELLDGLTQFIQK
HQREQGKSFVSRTRISPARYFRQATVVFRVVLANPLTSHDILNQVLVEQSEIAALDKEFL
PALLAMVAE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgtcaagccacggcatctgaagaaagcctaatgcgtatattt
accgtgcccgaagatgcagaatcgacgctaagtattatcgagcagaagctttccgaggat
ttagcaggctttttgggtgacagcattgccgcgctcgaaaaacctttgtcggaaatcgaa
accgattttcaagcctttaagatcccaactcagccgcgttttgtctccgattacaccgat
gaaattatgcaaaatctggtggcgcattcggtacatacctctgcgccaagttttattggt
catatgacatcggccctgccttattttgtgttgcccctgtcgaaaatgatggtaggtctg
aatcaaaatctggtcaaaatcgaaacttctaaggcatttacaccgcttgagcgccaagtg
cttggcatgatgcatcatttgatttacgcccaaaatacggatttttatcaaagctggatg
cacagtgcgaatcattccctcggggctttttgttcgggcggtacggttgccaatatcacg
gcgctgtggattgcccgtaaccaattattaaaggcagatggtgagtttaaaggtgttacc
cgcgaagggctactcaaggcgctgcgctattatggttatgatgatttagcgattttagtc
tcggaacgcgggcattactccctaggtaaagcggtcgatctgctcggtattggtcgcgac
aatatcattagtattcccacggatagccacaataaagtcgatatcgccaagatgcgcaaa
gcggcgcttgaacttgcccgtaaaaacatcaaggtattggcaattgttggcgtggctggt
acaaccgaaactggtaatgtcgacccgctgattgagttagctgcgctggcaaaagagcta
aattgccatttccatgtagatgcagcatggggaggtgcgagtttattatccaataaatac
cgccacttactcgcaggtatcgaacttgctgattcggtgactattgatgcccataagcag
atgtatgtgcctatgggcgctggcatggtgttatttaaaaaccccgagtttgcccacgcc
attgcccaccatgcagaatatattttgcgccgtggttcaaaggatttaggcagtcaaacg
ctggaaggttcgcgccccggcatggcgatgttagtgcacgcttgcttacagatcatcggc
ctcgatggttatgaaatcttaatcaataacagcattgaaaaagcccgttattttgccgaa
caaatcaaagcccatagggattttgagctagtcactgagcctgaactttgcctactaacc
tatcgttatgtgcccgccaaggtgcaagccgcgatgcaagtggcgattgagcaaggtgac
actgcaaaacttgcacgctttaatgaactgctcgatgggcttacccagtttattcaaaag
caccagcgcgaacagggcaaatccttcgtctcccgcacccgcatctcccccgcccgctat
tttagacaagcgaccgtggtgtttcgcgtggtgttagccaaccctctgactagccatgat
attcttaatcaagtgctggtcgagcaaagcgaaatcgccgcattagataaagagttttta
cccgcgctattggcgatggtggctgaatag

DBGET integrated database retrieval system