KEGG   Shewanella putrefaciens CN-32: Sputcn32_1637Help
Entry
Sputcn32_1637     CDS       T00513                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00061  Fatty acid biosynthesis
spc01100  Metabolic pathways
spc01212  Fatty acid metabolism
Module
spc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Sputcn32_1637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spc01004]
    Sputcn32_1637
Enzymes [BR:spc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Sputcn32_1637
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     Sputcn32_1637
Lipid biosynthesis proteins [BR:spc01004]
 Fatty acid synthase
  Component type
   Sputcn32_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ABP75362
UniProt: A4Y5X9
LinkDB All DBs
Position
complement(1865643..1866158)
Genome map
AA seq 171 aa AA seqDB search
MNKANSFNKEELIACGHGKLFGPNSPRLPVDNMLMIDRIVTINDNGGEFGKGEIVAELDI
NPELWFFDCHFISDPVMPGCLGLDAMWQLVGFYLGWEGAEGKGRALGVGEVKFTGQVLPG
AKKVTYKLNIKRTIHRKLVMGIADAILEVDGRQIYSATDLKVGVFSDTSTF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagcaaacagtttcaataaagaagaactcatcgcctgtggccatgggaaatta
tttggtccaaactcccctcgccttcctgttgataatatgctgatgatcgatagaatcgtc
actatcaatgataatggtggcgagtttggaaaaggtgaaattgtcgctgaactcgatatt
aatccagaattatggttttttgactgtcattttattagcgatcccgttatgcctggttgt
ttaggccttgatgccatgtggcaattagtagggttctatttaggctgggaaggtgctgaa
ggtaaaggtcgtgcactgggcgttggtgaagtgaagtttactggtcaagtgctacccggt
gcgaaaaaggttacctataaactgaatatcaaacgcacaatccaccgaaaactcgtcatg
ggaattgccgatgcaattcttgaagttgatggtcgtcaaatctacagcgcaaccgatctc
aaagtcggtgtatttagtgatacatcaaccttctaa

DBGET integrated database retrieval system