KEGG   Shewanella putrefaciens CN-32: Sputcn32_1687Help
Entry
Sputcn32_1687     CDS       T00513                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spc  Shewanella putrefaciens CN-32
Brite
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sputcn32_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABP75412
UniProt: A4Y629
LinkDB All DBs
Position
complement(1926439..1927023)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFADKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFEAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNYAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacttatgttgttaagctaaac
ggcttaatcgaaggaactgatttcgcagacaaatctttagaagaaatcatcaaaacttct
actggtggtgtatttaacaacgcagctcaagtgtggaaccacactttctactggaactgt
ttagcacctaacgctggcggcgagccaacaggtcctgtggcagatgccatcaatgcagcc
ttcggttcatttgaagcatttaaagcccaatttaccgattctgcagtgaataacttcggt
agcgcttggacttggttagtgaaaaaagccgatggtactgtggctatcgttaacacgagc
aacgccgcaacaccactgactgacagcactgtcacgccaattctgaccgttgacgtatgg
gaacacgcctactacatcgattatcgtaacgtgcgtccagactatttagcccacttctgg
caattagtgaactgggacttcgtgaaccaaaactacgcgggttaa

DBGET integrated database retrieval system