KEGG   Shewanella putrefaciens CN-32: Sputcn32_1801Help
Entry
Sputcn32_1801     CDS       T00513                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00473  D-Alanine metabolism
spc00550  Peptidoglycan biosynthesis
spc01100  Metabolic pathways
spc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sputcn32_1801
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputcn32_1801
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Sputcn32_1801
Enzymes [BR:spc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sputcn32_1801
Peptidoglycan biosynthesis and degradation proteins [BR:spc01011]
 Precursor biosynthesis
  Amino acid ligase
   Sputcn32_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp Birna_VP2
Motif
Other DBs
NCBI-ProteinID: ABP75525
UniProt: A4Y6E2
LinkDB All DBs
Position
complement(2046504..2047517)
Genome map
AA seq 337 aa AA seqDB search
MSRINLLLLCGGGSAEHDISLMSANYFESSLAKSDQFSVLRVELDKLGQYRTAAGDDCEL
TNNREIRFRDETKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLHQYDDEAISQAQTALANWGSIFIKAASQGSSVGCYKVDDS
SKVAQVLKDAFGYAPYVVVEKTIKARELEVAVYEYNGEIVATLPGEIICDTNTFYTFDEK
YAKSSKARTDVVAKDVSVELSEQIRAYAIKAFKGMKLRHLSRIDFFLTAENEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINSQLSAKD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaattaacttacttttgctgtgcggcggcggaagtgctgaacacgatatttca
ctaatgtcggctaactattttgaatcctcattggcaaaatccgatcaattttccgtgtta
cgggtagaacttgataaattgggtcaatatcgcaccgcggcaggcgatgattgtgaactg
acgaataatcgcgaaatccgttttcgcgatgaaactaaagcgccttggcctgtggactat
gttattccttgcatccatggttatcccggcgaaacaggtgatatccagtcctatttcaac
cttattcaactgccctacttcggctgtgaatccgaagccagtagtaattgtttcaataaa
atcaccgccaaaatgtggttttcagccctagggatccccaatactccctacatttttcta
caccaatatgatgatgaggcgatcagccaagcacaaaccgccttggctaattggggttca
atctttattaaagccgcgtcgcaaggatcatctgtcggttgctataaagtggatgacagc
agcaaagtggcacaagtactcaaagatgccttcggctatgctccctatgttgtagtagaa
aaaaccataaaagcccgtgaattagaagtcgcagtatacgaatacaatggtgagattgtg
gcaaccctgccgggtgagattatctgtgataccaataccttctacacctttgatgaaaaa
tacgccaaaagcagtaaggcacgcaccgatgtggttgcaaaagatgtttctgtagaactc
agtgaacagatccgtgcttatgctatcaaggcatttaaggggatgaagctgcgtcacctg
tcacgtatcgactttttcttaaccgctgaaaatgaaattttactcaatgaaatcaataca
ttcccaggttcgacaccgatttcaatgttccctaaaatgttgcaaaaccacggccacgac
tttaccgaatatttaagcctagtgatcaacagccagttatcggcaaaggattaa

DBGET integrated database retrieval system