KEGG   Shewanella putrefaciens CN-32: Sputcn32_2869Help
Entry
Sputcn32_2869     CDS       T00513                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00550  Peptidoglycan biosynthesis
spc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputcn32_2869
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sputcn32_2869
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spc01011]
    Sputcn32_2869
Enzymes [BR:spc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sputcn32_2869
Peptidoglycan biosynthesis and degradation proteins [BR:spc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Sputcn32_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABP76588
UniProt: A4Y9F5
LinkDB All DBs
Position
3330463..3332319
Genome map
AA seq 618 aa AA seqDB search
MSPKKRITMHDHAAEASLFKRRALFTFCCVVALLSVLVTNLYHLQVESYKDYETRSNDNR
IRVVPIAPSRGLIYDRNGILLAENQPFYSLDLIPEKISKMQETLDELGKLIEISEEEREN
FTEALKFHRRFKPLTLKNQLTEEQVAIFSVNQHRFPGISVEAGLKRNYPYNSQLTHVLGY
VGKINTRDRAQLERSDLWKNYAATKDIGKQGIEKFYESLLHGIPGHLEEEVNNRGRTIRT
LKIVPPEPGQDIYLTIDLKLQQKAVELLQGHKGSIVAIDPRDGGILALVSSPSYDPNQFV
QGINSKDYNDLLNDKSRPLINRATQGQYAPASTIKPMVALLGLDEKVVTEHTRIWDPGFW
QIPGVERKYRDWKRWGHGWVNVYSAIIESCDTYFYELAYKVGVDAIARFMEPFGFGQNTG
IDIFEESAGNMPSKDWKRLKYNQAWYIGDTISVGIGQGYWTATPLQLANATAILANKGRR
FQPHLLKSIKDNTAKIDTPVNELPPIELKNARNWNIINEAMRQTAHKSRFTDANYSAAMK
TGTAQVIGVAENTKYDADKIAEHFRDNALVIAYAPFEDPKIVLAVVMENAGWGGANAGPV
ARAMLDEYMLRDTWKPTP
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccaaaaaagcggataacaatgcatgatcacgccgccgaggcgtcactctttaag
cgccgtgcgctattcactttttgctgtgtagtcgccctattaagcgtattggtgaccaac
ctttatcatctacaggttgaatcctataaggattatgaaacccgctctaacgataaccgt
attcgtgttgtccctatcgcccccagccgtggtttaatttacgatagaaacggtatactc
ctagctgaaaaccaacccttttattccctcgatcttatccccgaaaaaatctcaaaaatg
caagagaccttagatgagctaggcaagctcattgagatcagcgaggaagaacgagaaaac
tttaccgaagcgctgaaatttcatcgccgctttaaaccgctcacacttaaaaatcagctt
actgaagagcaagtggcgatttttagtgttaaccagcacagatttcccggtatttctgtc
gaagcagggctaaaacgtaattatccttacaatagccaattaacccatgtgctcggttat
gtaggaaaaattaatacccgtgatcgcgcccagttagaacgtagtgatctatggaaaaac
tatgctgcaaccaaagatattggtaagcaagggattgaaaagttttatgaatcattacta
catggtattccgggccatctcgaagaagaagtgaacaaccgtggccgcacaatccgcacc
ttaaaaattgtgccgccagagcctgggcaagatatatatctaacaatcgatttaaaactg
cagcaaaaggcagtggagttacttcaaggacataagggttctattgtcgcgatagatcca
agagatggcggcattttagcattagtatcaagcccaagttatgatccaaaccaatttgtt
caaggtattaacagcaaagattacaatgatttactcaatgataaatctcgacctttgatc
aacagggcaacccaaggacagtatgcccccgcatcaacgattaagcctatggttgcccta
ctcggcttggatgaaaaagtcgttactgaacatactcgcatttgggatcctggattttgg
caaatcccaggtgtagaacgtaaatatcgcgattggaagcgttggggtcatggatgggtt
aacgtctatagtgcgattatagaatcctgtgatacctacttttatgagttagcttataaa
gttggcgtcgatgccattgcgcgttttatggaaccttttggctttggacaaaataccgga
atagatatttttgaggaatccgcaggtaatatgccctctaaggattggaaacgcttaaaa
tacaatcaagcctggtatataggtgacaccatttcagttgggatcggccaaggttattgg
acagcaaccccattacaactggccaatgctactgccattttagccaataaggggcgtcgt
tttcagccgcatttactcaaatctatcaaggataatacggcaaaaattgacactccagtt
aatgagttaccgccaatagaacttaagaatgctcgtaactggaatattatcaatgaagcg
atgcgccagacggctcataaatctcgtttcaccgatgcaaactattcagctgcaatgaaa
acaggaacggctcaggtaattggcgtagctgaaaatacaaaatacgatgcggataaaatt
gcagaacactttcgtgataatgcattagtgattgcttacgccccctttgaagatcctaaa
atcgtactcgcagtcgtcatggaaaacgcgggttggggtggtgcgaatgcaggtccagtt
gctcgtgccatgctggatgaatacatgcttagagacacttggaaaccaacgccatga

DBGET integrated database retrieval system