KEGG   Shewanella putrefaciens CN-32: Sputcn32_2873Help
Entry
Sputcn32_2873     CDS       T00513                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00550  Peptidoglycan biosynthesis
spc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputcn32_2873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spc01002]
    Sputcn32_2873
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spc01011]
    Sputcn32_2873
Enzymes [BR:spc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sputcn32_2873
Peptidases and inhibitors [BR:spc01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Sputcn32_2873
Peptidoglycan biosynthesis and degradation proteins [BR:spc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Sputcn32_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 CytoC_RC
Motif
Other DBs
NCBI-ProteinID: ABP76592
UniProt: A4Y9F9
LinkDB All DBs
Position
3335478..3336653
Genome map
AA seq 391 aa AA seqDB search
MMNFVKSPIKTLLLISSVSLPVYAAQPIVTPDAPTVAAKAYVLMDYYSGQIIAESNAYES
LNPASLTKMMTSYVIGQEIKAGNVSPEDDVTISKNAWSKNFSDSSKMFIEVGKTVKVADL
NRGIIIQSGNDACVAMAEHIAGTEGAFVDMMNSWSKQLGMRDSYFENSHGLDSDNHKTTA
YDMALLGAALIRDVPEEYRVYSEKFYTFNGIKQYNRNGLLWDNSMNVDGIKTGHTSGAGY
NLVASATKDGMRLISVVMGTQSEAARKAESKKLLTYGFRFFETITPYKAGDNFTTQQIWY
GDKSTVDLGVATDTPITVSRGRAKDLKANFELTKQLDAPLKKGETVGRLFFQLDGKDIAQ
YPLVTLQEVNEGSWFSKLVDYFKQLFSGWFS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattttgtaaaaagtcccattaaaacattgctgctaatttctagtgtctctctc
cctgtttatgctgcgcagcctattgttacacctgatgcacccactgttgccgccaaggct
tacgtcttgatggattactattcgggccaaattattgcagaaagcaatgcctatgagagc
ctaaaccctgccagtttaactaagatgatgaccagttatgttattggccaagaaattaaa
gcaggcaatgtctcccctgaagatgatgtgaccatcagtaaaaatgcgtggtctaaaaac
ttctctgattcttctaaaatgtttatcgaagttggcaaaaccgtaaaagttgcagactta
aaccgaggaattatcatccaatcaggcaatgatgcctgtgttgccatggctgagcatatc
gctggaaccgaaggtgcgttcgtcgatatgatgaattcatggtcaaaacagcttgggatg
cgtgatagctactttgaaaactcacacggccttgattctgataaccacaaaacgactgct
tatgatatggcattgttaggtgccgcacttattcgagacgtgcctgaagaataccgtgta
tatagtgaaaaattctatactttcaatgggatcaaacaatataaccgcaatggtttattg
tgggataacagtatgaatgtggatggcattaaaactggccacacctctggagcgggttat
aacttagtcgcttcggcaaccaaagatggtatgcgcttgatctctgtcgtgatgggtaca
caaagtgaagccgcccgtaaagcagaaagcaaaaaactgcttacctatggcttccgtttc
tttgaaacgattacgccatataaagcaggtgataactttaccactcaacagatttggtac
ggtgataagagcactgtcgatttaggcgttgcaactgatacaccgatcactgtcagccgt
ggccgcgcaaaagacttaaaagccaattttgagctaactaaacaattagatgcaccgctg
aaaaaaggtgaaactgtaggtcgactatttttccaactagatggaaaagacatagcacaa
tacccattagtcaccttacaagaagtgaatgagggaagctggtttagtaaattagttgac
tactttaaacagctgttttctggatggtttagctaa

DBGET integrated database retrieval system