KEGG   Shewanella putrefaciens CN-32: Sputcn32_3902Help
Entry
Sputcn32_3902     CDS       T00513                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00260  Glycine, serine and threonine metabolism
spc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sputcn32_3902
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Sputcn32_3902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_3 FAD_binding_2 Pyr_redox_2 Methyltransf_25 TrkA_N UDPG_MGDP_dh_N FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABP77608
UniProt: A4YCC5
LinkDB All DBs
Position
4527869..4528894
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEKGIWLVDAPKPEMGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTIPVPMV
VGHEYVGEVVDIGQEVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTSGVGVNREGS
FAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSKENLKDVMKELGMTEGFDVGLEMS
GVPSAFHAMLDTMNHGGKVAMLGIPGGEMAIDWSKVIFKGLVIKGIYGREMFETWYKMAS
LIQSGLDISPIITHHYKIDDFQKGFDAMGSGQSGKVILSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactaagcaagttaaaagccgaaaaaggcatttggttagtcgatgcgcctaaa
cctgaaatgggccacaacgatctgctgatcaagattaaaaagaccgccatttgtggcacc
gacatgcacatctacaactgggacgaatggtcacaaaaaaccattcctgtgcctatggtg
gtcggccacgaatatgtgggtgaagtggttgatatcggccaagaagtccgtggttttaaa
atcggtgaccgtgtttctggcgaaggccatatcacctgtggccactgccgtaattgccgc
gcgggtcgcacccatctatgtcgtaatacctcaggtgtgggtgtaaaccgcgaaggttca
tttgccgaatacttagttatccccgcctttaacgcctttaaaatccctgatgatatcagc
gatgatttagcctcaatctttgacccatttggtaacgcagtacacacggcactgtcattc
gatttagtcggcgaagacgtgttgatcacaggcgcaggtcctatcggtatcatggcagca
gcagtatgtcgtcatgtaggtgctcgccatgtggtgattaccgacgttaacgaataccgc
ttagagctggcccgaaaaatgggggcgactcgcgctgtaaacgtatcaaaagaaaatcta
aaagacgtgatgaaagaactcggcatgaccgaaggttttgatgttggattagaaatgtct
ggcgtaccatcggccttccacgccatgttagataccatgaaccacggcggtaaagtcgct
atgctcggtattccgggtggcgaaatggccattgattggagcaaagtgatcttcaaaggt
ttggtcattaaaggcatttacggccgtgaaatgttcgaaacttggtacaagatggcaagc
cttatccaatctggcttagacatttccccaatcatcactcaccactacaagattgatgat
ttccaaaaaggctttgacgctatgggctcgggtcaatcgggtaaagtcatcctcagctgg
gattaa

DBGET integrated database retrieval system