KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1043Help
Entry
SPD_1043          CDS       T00413                                 

Gene name
nrdF
Definition
(GenBank) ribonucleoside-diphosphate reductase, beta subunit
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00230  Purine metabolism
spd00240  Pyrimidine metabolism
spd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPD_1043 (nrdF)
   00240 Pyrimidine metabolism
    SPD_1043 (nrdF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spd03400]
    SPD_1043 (nrdF)
Enzymes [BR:spd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     SPD_1043 (nrdF)
DNA repair and recombination proteins [BR:spd03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SPD_1043 (nrdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm DUF3364
Motif
Other DBs
NCBI-ProteinID: ABJ55458
UniProt: A0A0H2ZQ78
LinkDB All DBs
Position
1072166..1073128
Genome map
AA seq 320 aa AA seqDB search
METYYKAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSNKEKDLVGKVFG
GLTLLDTMQSETGVQALRADIRTPHEEAVFNNIQFMESVHAKSYSSIFSTLNTKAEIEEI
FEWTNTNPYLQKKAEIVNEIYLNGSPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANV
AEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTESLY
DGVGWTEEVKTFLRYNANKALMNMGQDPLFPDSAEDVNPIVMNGISTGTSNHDFFSQVGN
GYLLGEVEAMQDDDYNYGLD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttactacaaagccattaactggaatgccatcgaagatgtcatcgacaaatca
acttgggaaaaactgacggagcaattttggctcgatacacgtattcccttatcaaacgac
ttggatgactggagaaagctatctaacaaagagaaagacttggtcggaaaagtttttggt
ggtttaacccttcttgacactatgcaatctgaaactggggttcaagcccttcgcgcagac
atccgtacaccacatgaggaagctgttttcaataacatccaatttatggaatctgtccac
gctaaatcttactcatcaatcttttctaccttgaatactaaggctgagattgaagaaatt
ttcgaatggaccaataccaatccttacctacaaaagaaggctgagattgtcaacgaaatc
tacctaaacggcagcccacttgaaaagaaagttgccagcgtcttcctcgaaaccttcctc
ttctactctggtttcttcactcccctctactatctcggtaacaacaaactagccaacgtt
gcagaaatcattaaattgattattcgtgacgagtctgttcacggaacctacattggttac
aaattccaacttggtttcaatgaattgcctgaagaagagcaagaaaaactcaaagaatgg
atgtacgacctactctatactctttatgaaaatgaagaaggctacacagagagtctttat
gacggtgttggttggactgaagaggttaaaaccttccttcgctacaatgccaataaagct
ctcatgaacatgggacaagatccacttttcccagattcagctgaagatgtcaacccaatc
gttatgaacggtatttcaacaggaacttccaaccatgacttcttctctcaagtcggaaat
ggttaccttcttggcgaagttgaagccatgcaagacgatgactataactacggtttagac
taa

DBGET integrated database retrieval system