KEGG   Serratia proteamaculans: Spro_0081Help
Entry
Spro_0081         CDS       T00595                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spe  Serratia proteamaculans
Brite
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Spro_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABV39191
UniProt: A8G7V1
LinkDB All DBs
Position
complement(85281..85901)
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELAQYSVEDLIQD
LDKVPADKRTFMRNNAGGHANHSLFWKGLKIGTTLGGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPIVGLDVWEHAYYLKYQN
KRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccgtacgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacaccaaacatcaccagacttacgttaacaacgccaac
accgtgctggaagcttacccagaactggctcaatacagcgttgaagacctgatccaggat
ctggataaagtgcctgctgacaagcgcaccttcatgcgtaacaacgccggcggccacgct
aaccacagcctgttctggaaaggcctgaaaatcggcaccactctgggtggcgatctgaaa
gcggctatcgaacgtgatttcggcagcgttgagaaattccaggaagagttcgagaaagcc
gcagcgacccgcttcggttcaggttgggcctggctggtactgaaaggcgacaaactggct
gtagtgtctactgctaaccaggacagcccgctgatgggcgaagccgttgccggcgcttca
ggcttcccaatcgtgggcctggacgtgtgggaacacgcttactacctgaaatatcaaaac
aaacgtccagactacatcaaggcattctggaacgtggttaactgggatgaagcggcagca
cgcttcgctgcgaagaagtaa

DBGET integrated database retrieval system