KEGG   Serratia proteamaculans: Spro_0344
Entry
Spro_0344         CDS       T00595                                 

Definition
(GenBank) phosphoribosylglycinamide synthetase
  KO
K22114  dapdiamide synthase [EC:6.3.2.47]
Organism
spe  Serratia proteamaculans
Pathway
spe00997  Biosynthesis of various secondary metabolites - part 3
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
Module
spe_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Spro_0344
Enzymes [BR:spe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.47  dapdiamide synthase
     Spro_0344
SSDB
Motif
Pfam: ATP-grasp_4 GARS_A RimK ATP-grasp_3 LAL_C2 GSH-S_ATP ATPgrasp_Ter Dala_Dala_lig_C
Other DBs
NCBI-ProteinID: ABV39454
UniProt: A8G8L4
LinkDB
Position
395402..396676
AA seq 424 aa
MPILNNKEVIVIIDAWSGGKYLIPAFQALGYFCLHVQSPFLPAVFVADNQLAIARSDRHV
VHDGDIETLLNALQPYAIKAILAGSEGAVALADRLNDALALAFSNRFELSAARRNKFLMQ
EQLARRGVASIKQRLTADCDELQQWLASHDRWPVVLKPVQSAGTDGVFICHDLAQATQAF
DAILAKKDLFGSPNREVLCQEFLVGEEFVVNGIACQGEYFFTELWQSKKQQRNGFPVYET
QYLHYRNDAGFDVLAAYTAQVCQALGIENGAFHAEVMMTQSGPVLIEIGARVAGGADPYI
IEECLGHSQIGKLVQAVLHPEVFLQEVRRQRDFSGHRRAAYVFMISPSTGRVQSSPEARF
ISIDGVISVNYHHMPGDIQQETRDLLSSPGVVIAIRDNPALLKQTIAEIRDVEGDFYHSG
LMAE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgccgattttgaacaacaaagaagtcatcgtgattattgacgcctggtctggcggcaaa
tatttgatccctgcatttcaggcgctcgggtatttttgcctgcacgtccaatccccgttt
ctaccggcggtcttcgttgcggataaccaactggccattgcccgcagcgacaggcatgtc
gttcatgatggcgatattgagacgctgctcaacgcgctacaaccttatgccatcaaggca
atacttgctggcagcgagggcgcggttgcactggccgatcgcttgaatgatgctctggcg
cttgcctttagcaatcggttcgaactctccgcggcgcggcgtaataaattcctgatgcag
gaacagcttgcccgcaggggtgtggcgtccatcaagcagcggctgactgctgactgtgat
gaattacagcagtggctggcgagccacgatcgctggccggtggtgctgaaaccggtgcaa
agcgccggtaccgacggggtatttatctgccatgacctggcgcaggccacccaggcgttt
gacgctattctggcgaaaaaagatctcttcggcagccctaaccgggaagtgctgtgccag
gagtttttggtgggcgaagagtttgtggtcaacggcattgcctgccagggagagtatttc
tttaccgagttgtggcagtccaaaaagcaacagcgcaacggttttcctgtgtatgaaacg
caatatctgcactatcggaatgacgccggcttcgatgtattggccgcctataccgcgcaa
gtgtgccaggcgcttggcatcgagaacggggcctttcatgccgaggtgatgatgacgcag
agcgggcctgtgttgattgaaatcggcgcccgggtcgccggcggtgcggacccttatatt
atcgaagagtgtctggggcattcgcagataggcaaattggtgcaggcggtcctgcaccct
gaggtgttcctgcaggaagttcggcggcagcgcgatttttccggccatcggcgcgccgcc
tatgttttcatgatttcgccctccacgggccgggtgcaaagctcgccggaagcgcgattt
atctctatcgacggtgttatcagcgtcaattatcaccacatgcccggcgatattcagcaa
gagacccgcgacctgctgagctccccaggggtggttattgccatccgagataaccctgcc
ttgctaaagcagacgattgcggagatccgagatgtcgaaggcgatttttaccactcgggt
ctgatggctgaataa

DBGET integrated database retrieval system