KEGG   Serratia proteamaculans: Spro_0345
Entry
Spro_0345         CDS       T00595                                 

Definition
(GenBank) Coenzyme F390 synthetase-like protein
  KO
K22113  fumarate---(S)-2,3-diaminopropanoate ligase [EC:6.3.2.46]
Organism
spe  Serratia proteamaculans
Pathway
spe00997  Biosynthesis of various secondary metabolites - part 3
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
Module
spe_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Spro_0345
Enzymes [BR:spe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.46  fumarate---(S)-2,3-diaminopropanoate ligase
     Spro_0345
SSDB
Motif
Pfam: AMP-binding GH3
Other DBs
NCBI-ProteinID: ABV39455
UniProt: A8G8L5
LinkDB
Position
396687..397859
AA seq 390 aa
MNLELWVKNIGTTFPWYAQLLGDKPADASRLETLPVITEELLTQHYYHAEHRLPGQYHSY
LTSGTTSGKRKRILYSDNDQRIYLQQRMGIIRDFCGEGHVRACADLGTGHAAATAGEIFQ
AMGCEVELIDFTRPIEQHIEVLNRFKPDIFFTMPMILDCLVATGKLDFQPKRIIVLGDVA
SLAWQRKVADYFHIKPGQVLDLFGSIEIGSIAFFDHALGRYRFDPYLLPEVVPVQSLYPD
AGYRGEGGILLLTSFAREYFPAVRFVTNDLIEGFAQEILEGRTVYTYQRCLGRFAGEFKH
GEKINLSDISDAMAKNLPYHRYDLDDHDGGLVIRIAAASISAQVSEAIKHDLLSRNPDIA
QMIASGLVGDIRIQCVDAQEIAGNVSKRRY
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaatttggaactatgggtaaaaaacattggcaccacattcccctggtatgcgcaattg
ctcggcgataagccggcggacgccagccgtctggagacgctgccggtgattaccgaggaa
ctgctgacgcagcattactatcatgcagagcataggttgcccgggcagtatcacagctat
ctgacctccggcaccacgtcaggcaagcgtaagcgcattctttattctgataacgatcag
cgtatttatttgcaacagcgcatgggcattatcagggatttttgtggggaagggcatgtt
cgcgcctgtgccgatttgggcaccggccatgcggccgcgacggccggcgaaattttccag
gcaatggggtgcgaggtcgaattgatcgatttcacccggccgattgagcaacatatcgag
gtgctcaaccgcttcaagcccgacatcttctttaccatgccgatgatacttgattgtctg
gtcgcgaccggcaaactcgatttccaaccgaagaggatcatcgtgctgggtgacgtggca
agcctagcttggcaacgcaaggtagcggactattttcatatcaaaccggggcaggtactc
gatctgttcggcagcattgaaatcggctccatcgctttttttgatcatgcgctggggcgc
taccggttcgatccttacctgttgccggaagtggtaccggtgcaaagcttgtaccccgat
gccggctaccgcggcgaaggcggtattttactgctcacctcatttgcccgtgaatacttc
cctgccgtccgctttgtgaccaacgatttgattgagggttttgcacaggagatcctcgag
ggacgaacggtttacacctatcagcgttgccttgggcgttttgccggtgaatttaaacat
ggggagaaaatcaacctcagcgatatcagtgatgctatggcaaagaacctgccttatcac
agatacgatctcgacgatcatgacggcggattggtgattcgcattgcggctgcgtcgatc
tcggcacaggtcagcgaagccatcaagcatgacctgctgtcgcgcaaccccgatattgcg
caaatgatagcttcgggactggtcggggatatccgcatccagtgcgtcgacgcgcaggaa
atcgccggcaacgtcagcaaacgccgctattga

DBGET integrated database retrieval system