KEGG   Serratia proteamaculans: Spro_0763Help
Entry
Spro_0763         CDS       T00595                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spe  Serratia proteamaculans
Pathway
spe00473  D-Alanine metabolism
spe00550  Peptidoglycan biosynthesis
spe01100  Metabolic pathways
spe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Spro_0763
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spro_0763
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Spro_0763
Enzymes [BR:spe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Spro_0763
Peptidoglycan biosynthesis and degradation proteins [BR:spe01011]
 Precursor biosynthesis
  Amino acid ligase
   Spro_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATP-grasp RimK ATPgrasp_ST TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ABV39869
UniProt: A8G9S9
LinkDB All DBs
Position
852203..853123
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLLGGTSAEREVSLQSGAAVLAGLREAGIDAHGIDIRDFPVTQLKEHGFTKVFI
ALHGRGGEDGTLQGMLEFLELPYTGSGVMASALTMDKWRTKMVWQSMGLPVAPYVALNRK
QYAGAEKATLIARVEALGLPLIVKPSREGSSVGMSKVTERDALEAALEEGFRHDDDVLVE
KWLSGPEYTVAMLGDQVLPSIRIQPAGVFYDYQAKYISDDTQYFCPSGLGAQQEAEMAAL
ALRAYRGLDCSGWGRVDVMQDSDGSFYLLEVNTSPGMTSHSLVPMAARQSGLSFSQLVAR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaagttgccgtactgctgggtggcacctctgctgaacgtgaagtgtcattg
caatccggcgccgccgtgctggccgggctgcgtgaagccggtatcgatgcccacggcatt
gatatccgtgacttcccggtaacccaactgaaagaacacgggtttaccaaagtctttatc
gcgctgcacggtcgcggcggcgaagacggcaccctgcaagggatgctggagttcctcgag
ctgccttataccggcagcggtgtgatggcttcggcgctgaccatggacaaatggcgcacc
aaaatggtgtggcagtcgatgggcttgccggtggcaccttatgtcgcgctgaaccgcaag
cagtatgccggtgccgagaaagcgacgctgattgcccgcgtggaggccctgggcctgccg
ctgatcgtcaagccgagccgtgaaggttccagcgtcggcatgagcaaagtcaccgagcgt
gacgcgctcgaagcggcgttggaagaaggtttccgccatgacgacgacgtgctggtcgaa
aagtggctgagcggcccggaatacacggtagcgatgttgggtgaccaggtattgccttcg
atccgcattcaaccggccggcgtgttttacgactatcaggccaagtacatttcggacgat
acccagtatttctgtccgagtggcctgggtgcgcagcaggaagccgagatggctgccctg
gcgttacgcgcctaccgtgggctggactgcagcggctggggccgcgtggatgtgatgcag
gatagcgatggcagcttctatctgcttgaggtgaatacctcgccgggcatgaccagtcat
agcctggtgccgatggcagctcgccagtctggtttaagcttctcgcagctggtagcgaga
attttggagttggccgactga

DBGET integrated database retrieval system