KEGG   Serratia proteamaculans: Spro_1265Help
Entry
Spro_1265         CDS       T00595                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
spe  Serratia proteamaculans
Pathway
spe00020  Citrate cycle (TCA cycle)
spe00190  Oxidative phosphorylation
spe00650  Butanoate metabolism
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
Module
spe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spro_1265
   00650 Butanoate metabolism
    Spro_1265
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Spro_1265
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Spro_1265
    1.3.5.4  fumarate reductase (quinol)
     Spro_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO FAD_binding_3 BEX Thi4
Motif
Other DBs
NCBI-ProteinID: ABV40369
UniProt: A8GB79
LinkDB All DBs
Position
1389689..1391455
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQAGSSCALLSKVFPTRSHTVSAQGGITVALGNN
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGLPFSRTDDGRIYQRPFG
GQSLNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGT
TAICIETGEVVYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHVKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLQ
ESILEQGASREASESDVEASLDRLNRWNNTRSGEDPVEIRKALQACMQHNFSVFREGDAM
AKGLEELKEIRERLKNARLDDTSSEFNTQRIECLELDNLMETAFSTAVSANFRTESRGAH
SRFDFPERDDANWLCHSLYQPQSESMTRREVNMQPKLRPAFPPKVRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccggtcagagagtttgatgctgtagttatcggtgcaggcggtgcaggtatg
cgcgcggcactgcaaatttctcaagcgggttcttcttgtgccctgctgtccaaagtattc
ccgacccgttcccataccgtgtctgcacagggcggcattaccgtagccctgggtaataac
cacgaagataactgggaatggcatatgtatgacacggtgaaaggttccgattatatcggt
gaccaggacgccattgagtatatgtgtaaaaccggcccggaagcagttctggagctggag
catatggggctgccgttctcccgtaccgacgatggccgcatctatcagcgcccattcggc
ggccagtcactgaatttcggtggcgagcaggctgcacgtaccgctgcggcggctgaccgt
accggtcacgccctgctgcacaccctgtatcaacagaacctgaaaaatcacaccactatc
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcagtggtcggcacc
acggctatctgtattgaaaccggtgaagtggtttacttcaaagccaaagccaccgtgctg
gcgaccggcggtgcaggccgtatttaccagtccaccaccaacgcccatatcaacaccggt
gacggtgtcggcatggcgctgcgtgccggcgtgccggtgcaggacatggaaatgtggcag
ttccacccgaccggcatcgccggtgccggggttctggtgaccgaaggttgtcgtggtgaa
ggcggttatctgctgaacaaacacggtgagcgtttcatggagcgctatgcgccgaacgcc
aaagacctggcgggccgtgatgtggtagcccgttcgatcatgattgaaatccgcgaaggc
cgtggctgtgacggtccgtggggcccgcacgttaagctgaagctggatcacctgggtaaa
gaagtgctggaatcccgcctgccgggcattctggaactgtcgcgcaccttcgcgcacgtc
gacccagtgaaagagcctatcccggttatcccaacctgccactatatgatgggcggtatt
ccgaccaaagtgaccggccaggcgttgaccgtgaatgagaaaggcgaagacgtagtgatc
ccggggctgttcgcagtgggcgaaattgcctgcgtatcggtgcacggcgccaaccgtctg
ggcggcaactcgctgctggatctggtggtgttcggtcgcgccgccggcatgcatctgcag
gaatctatcctcgagcagggcgccagccgtgaagcgagcgaatccgatgtagaagcgtcg
ctggatcgtctgaaccgctggaacaacacccgttcaggtgaagatccggttgaaatccgc
aaggcgctgcaagcctgtatgcaacacaacttctcggtattccgtgaaggtgatgcgatg
gcgaaagggctggaagaactgaaagagatccgtgaacgtctgaagaacgcacgtctggac
gatacctccagcgaattcaacacccagcgcatcgaatgcctggagttggataacctgatg
gagaccgcgttttccaccgccgtgtcggccaacttccgtaccgagagccgtggcgcgcat
agccgcttcgacttcccggaacgtgatgatgccaactggctgtgtcactcgctgtatcag
ccgcaatcggaaagcatgacgcgtcgtgaagtgaacatgcaaccgaagctgcgcccggca
ttcccgccgaaagtgcgttcttactaa

DBGET integrated database retrieval system