KEGG   Serratia proteamaculans: Spro_1266Help
Entry
Spro_1266         CDS       T00595                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
spe  Serratia proteamaculans
Pathway
spe00020  Citrate cycle (TCA cycle)
spe00190  Oxidative phosphorylation
spe00650  Butanoate metabolism
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
Module
spe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spro_1266
   00650 Butanoate metabolism
    Spro_1266
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Spro_1266
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Spro_1266
    1.3.5.4  fumarate reductase (quinol)
     Spro_1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ABV40370
UniProt: A8GB80
LinkDB All DBs
Position
1391472..1392188
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYSLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGINMNGKNGLACITPVSSLTKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPF
LQNDGKNPPAREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETEERLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRGA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttcaatttatcgctacaatccggatgttgacgatgctccgcacatg
caggactacagcctggaagcggaagaaggtcgcgacatgatgttgctggatgcgttgatc
cagctgaaagaaaaagatccaagcctgtcgttccgtcgttcatgccgtgaaggcgtttgt
ggttccgatgggatcaacatgaacggtaaaaacggcctggcctgtatcactccggtgtcg
tcgctgaccaaaggcaataaaaagattgtgatccgtccgttaccaggcttgccggtagtg
cgcgatctggtggtcgatatgggccagttctacacccagtatgaaaagatcaagcctttc
ctgcagaacgacggcaagaacccgccggcgcgtgagcacctgcaatcgccggaagagcgt
gccaagctcgatggtctgtacgagtgcattttatgcgcttgttgttcgacctcttgcccg
tcattctggtggaatcctgacaagtttatcggcccggctggcctgttggcggcgtaccgc
ttcctgattgacagccgtgacacggaaacggaagaacgtttagacgatctggacgacgct
ttcagtgttttccgctgccatagcattatgaattgtgtcagtgtatgccctaagggcttg
aatccgacccgtgcaatcggtcatatcaagtctatgctgctgcaacgcggcgcataa

DBGET integrated database retrieval system