KEGG   Serratia proteamaculans: Spro_1628Help
Entry
Spro_1628         CDS       T00595                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
spe  Serratia proteamaculans
Pathway
spe00550  Peptidoglycan biosynthesis
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spro_1628
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spe01002]
    Spro_1628
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spe01011]
    Spro_1628
Enzymes [BR:spe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Spro_1628
Peptidases and inhibitors [BR:spe01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Spro_1628
Peptidoglycan biosynthesis and degradation proteins [BR:spe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Spro_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ABV40732
UniProt: A8GC92
LinkDB All DBs
Position
1783695..1784900
Genome map
AA seq 401 aa AA seqDB search
MMKRNLPSTLKKLTFSVSILLLAVPVVQAAEAPAAPQVDAKAYVLMDYNSGKILAEGNAD
TRLDPASLTKIMSSYVIGQAIKAGKIKPEDMVTVGKDAWATGNPALRGSSLMFIKPGDQV
PVMELNKGIVIQSGNDASIALADYVAGSQDSFVGLMNNYAKSLGLQNTHFLTVHGLDAEG
QYSTARDMALLGQALIRDVPDEYALHKEKEFTFNKIRQVNRNRLLWSTNLSVDGIKTGYT
GGAGHNLVASATDGPMRLISVVLGAPSDRIRFSESEKLLTWGFRFYETATPIKTDKPFVT
QKVWFGDVGEVPLGVAKDAAVTIPKGQMKNLKASYKLNQPTLEAPLAKNQVVGTIDFQLD
GKTIEQYPLVAMQEVKEGNFFSRIWDMVMMKLTQWFGSVFG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagaaacttacctagcactctgaaaaaattaacttttagcgtcagcatattg
ttgctggccgtacctgttgttcaggcggccgaagcgccggccgcgccacaggttgacgcc
aaggcctatgtgctgatggattacaacagcggaaaaatcctggcggaaggcaatgccgac
acccgtcttgaccccgccagcctgaccaagatcatgtccagctatgtgatcggccaggcg
atcaaggccggcaagattaaacctgaggatatggtgaccgtgggtaaggatgcctgggca
accggcaacccggcgctgcgcggctcctcgttgatgtttatcaagccgggcgatcaggtg
ccggtcatggaactgaacaagggcatcgttattcagtcgggtaatgatgccagcatcgcg
ttggctgattatgtcgcgggcagccaggattcgtttgttggcttgatgaacaactacgcc
aaatccctgggcctgcagaatacccatttcctgacggtgcacggcctggatgcggaaggg
cagtacagcaccgcacgcgatatggcgctgctcggccaggcactgatccgcgatgtgccg
gatgagtacgcgttgcacaaagaaaaagagttcaccttcaataaaattcgtcaggttaac
cgcaaccgtctgttgtggagcaccaacctgagcgtcgatggcatcaaaaccggttatacc
ggtggcgccgggcataacctggtagcctccgctaccgacgggccaatgcgtttgatttcg
gtagtgctgggggcgccaagcgaccgtatccgctttagtgaaagtgaaaaactgctgacc
tggggtttccgcttctacgaaaccgccacgccaatcaagactgacaagccgtttgtgacc
cagaaagtgtggtttggcgacgtcggcgaagtgccattgggcgtagcaaaagacgcagcc
gtcaccatcccgaaagggcagatgaaaaacctgaaggccagttacaagctgaaccagccg
acgctggaagccccgctggcaaaaaatcaggtggtcggcaccattgatttccagcttgat
ggtaaaaccattgagcagtacccgctggtggcgatgcaggaagtgaaagaaggtaacttc
ttcagccgcatctgggacatggtgatgatgaagctgacccagtggttcggtagcgtgttt
ggttaa

DBGET integrated database retrieval system