KEGG   Serratia proteamaculans: Spro_2221Help
Entry
Spro_2221         CDS       T00595                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spe  Serratia proteamaculans
Pathway
spe00480  Glutathione metabolism
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Spro_2221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spe02000]
    Spro_2221
Enzymes [BR:spe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Spro_2221
Transporters [BR:spe02000]
 Other transporters
  Pores ion channels [TC:1]
   Spro_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_C_6 GST_N_5 DUF4422
Motif
Other DBs
NCBI-ProteinID: ABV41322
UniProt: A8GDY2
LinkDB All DBs
Position
complement(2421879..2422484)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLALKKTESGANYLTINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRALIPAAGTLSRYHAIEWLNYIATELHKGFSPLFNPKTPEE
YKTIAREKLDTQFDYLDSVLAKQHFLLGNKFSVADAYLFTILRWAIALQFDIKKRSQLSA
YFDRVAARPAVDATLNAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaagccggcgcctgttctctgtccccccatattgtattgcgcgaa
gcaggcctggacttcaccgcagaaaaggtcgatctggcgctgaaaaagaccgaaagcggt
gcgaactatctgaccatcaacccgaaaggacaggtcccggcgctgctgctggatgatggc
agcctgctgaccgaaggcgtggcaattgtgcaatatctggcggatcgcgtgccggatcgc
gctctgatccccgcagcaggtacgctgtcgcgttatcatgccattgaatggctgaactat
attgccactgagctgcacaaggggttcagtccgctgtttaacccgaaaacgcctgaagaa
tacaaaaccatcgcgcgggaaaaactggacacgcagtttgactatctggattcggtgctg
gcgaagcagcatttcctgttgggcaacaagttcagcgtggcggatgcctatttgttcacc
attctgcgctgggccatcgccctgcagtttgatatcaaaaagcgcagccagctttcggcc
tattttgatcgcgtggccgcgcgacctgcggtggacgcaacgttgaatgcggaaggcttg
aaataa

DBGET integrated database retrieval system