KEGG   Serratia proteamaculans: Spro_2705Help
Entry
Spro_2705         CDS       T00595                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
spe  Serratia proteamaculans
Pathway
spe00240  Pyrimidine metabolism
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Spro_2705
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Spro_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: ABV41806
UniProt: A8GFB6
LinkDB All DBs
Position
complement(2981414..2981998)
Genome map
AA seq 194 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNESMLYAMIAQEHQQQLVHCVLLDESQFLTKQQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDESGQAMHAGEQVVIGGNESYVS
VCRKHYKEAIQALE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactctgctatgaacgcagggaaatctaccgcgttgttg
caatcttcatataattatcaagagcgtggtatgcgcacgttggtgtttaccgccgaaata
gatcatcgatttggtgtcggtaaggtcagctcgcggatcgggctgtcgtcacaggcgcag
ctctataataatgagtcgatgctctatgcgatgattgcacaggaacatcaacagcaactg
gtacattgcgtgttgttggatgaaagtcagttcctgacgaaacagcaggttgagcaattg
tgtgatgtcgtcgaccaactggatattccggttctgtgttatggcttgcgtaccgacttc
ctgggggaactgttcattggcagccaatacttgctggcctgggcagacaaactggtagag
ttgaaaaccatctgccattgcggacgcaaggccaatatggtgctacggctggatgaaagc
gggcaggctatgcatgccggtgagcaggtagtgataggggggaacgagagctatgtctcc
gtttgccgcaagcattacaaggaagccatacaggcactggagtag

DBGET integrated database retrieval system