KEGG   Serratia proteamaculans: Spro_3115Help
Entry
Spro_3115         CDS       T00595                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
spe  Serratia proteamaculans
Pathway
spe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:spe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spro_3115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spe02000]
    Spro_3115
Transporters [BR:spe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    Spro_3115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: ABV42215
UniProt: A8GGH5
LinkDB All DBs
Position
3428459..3429487
Genome map
AA seq 342 aa AA seqDB search
MHRVTLIAVLAAGSALSASPVFAAGKLNMICSADVVVCEQMTNLFEKQHPDIKVSMVRLS
AGEAYARIRTEARNPRTDIWWAGTGDPHMQAADEGLTQPYKSPLLDQQHDWARKQAESAG
YRTVGVYAGALGWGYNTRLLAEKKLKVPACWSDLLDPAYKGEIQMANPNSSGTAYNTLAT
LVQIMGEEPAFDYLKKLNANISQYTKSGSAPVKAAARGETTVGIVFMHDAVAMQVDGFPI
KAVAPCEGTGFEIGSMSIVKGARNLNEAKVWYDWALSADAQSHMKDAKSFQLPSNRNAAI
SEYAPRFENIKLIDYDFKTYGATEKRKALLSRWDKEIGASAQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgttactctgatagcggtcctcgccgctggctctgcactctctgcttcacct
gttttcgccgctgggaaattgaacatgatctgctccgccgatgtggtggtctgcgaacag
atgaccaacctgttcgaaaaacagcatccggatatcaaagtcagtatggtgcgcctctcc
gccggggaagcctacgcacgtattcgtaccgaagcccgcaatccgcgcaccgatatttgg
tgggcaggcactggcgatccgcatatgcaggccgcggacgaagggttaacccagccttat
aaatccccgttgcttgatcaacagcacgactgggcacgcaaacaggcggaaagcgccggc
taccgcaccgtgggtgtttatgccggggcgctcggttggggttacaacaccaggctattg
gcggagaaaaaactcaaggtgcctgcctgctggagcgacctgctggacccggcctacaaa
ggcgagatccagatggctaacccaaattcttccggtaccgcttacaacacccttgccacg
ctggtgcaaatcatgggcgaagaaccggccttcgactacctgaaaaagctcaacgccaat
atctcgcagtacaccaaatccggctcggcgccggtgaaggcagcggcacgcggcgaaacc
accgtcggtatcgtgtttatgcatgatgccgtcgcaatgcaggtcgatggcttcccaatc
aaagcagtagccccgtgcgaaggcacaggttttgaaattggttcgatgtcgatcgtcaaa
ggcgcacgcaacctcaatgaggccaaggtgtggtacgactgggcgctcagcgctgatgcg
caatcgcacatgaaagacgccaaatccttccagttgccgtccaatcgcaacgcggcgatt
tccgagtacgcgccacgctttgagaacatcaaactgatcgattacgactttaaaacctac
ggcgcgacagaaaaacgcaaggcactgctcagccgctgggataaagagatcggcgccagc
gcccaataa

DBGET integrated database retrieval system