KEGG   Serratia proteamaculans: Spro_3801
Entry
Spro_3801         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
spe  Serratia proteamaculans
Pathway
spe00230  Purine metabolism
spe00240  Pyrimidine metabolism
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Spro_3801
   00240 Pyrimidine metabolism
    Spro_3801
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     Spro_3801
    3.2.2.-  
     Spro_3801
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: ABV42897
UniProt: A8GIF7
LinkDB
Position
4201364..4202728
AA seq 454 aa
MITHISPLGSMDLLSQLEVDMLKRTASSDLYRLFRNCSLAVLNSGSQTDNSKQLLSRYET
FDINVLRRERGVKLELVNPPEDAFVDGRIIRSLQANLFAVLRDILFVHGQIDSAGRFQHL
NLENSAHITNLVFSILRNARALHLDEDPNLVVCWGGHSINENEYLYARKVGSQLGLRELN
ICTGCGPGAMEAPMKGAAVGHAQQRYHNSRFIGMTEPSIIAAEPPNPLVNELVIMPDIEK
RLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPENSEQVLPLILTGPKESANYFQVLD
EFIMNTLGDEARRHYTIIIDDPAEVARQMKKAMPLVKENRRNTGDAYSFNWSIRIAPDLQ
LPFEPSHENMANLNLYPDQPAEQLAAALRRAFSGIVAGNVKENGIHAIEQFGPYKLHGEP
QMMKQMDSLLQGFVAQHRMKLPGTAYVPCYEIVA
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgattacacacatcagcccgcttggctctatggatttgctgtcgcagctggaagtagac
atgctgaagcgtaccgccagcagcgatctttaccgtttgttccgcaactgttcgctggcc
gtcctgaactccggcagccaaaccgacaacagcaaacagctgctgtcacgctacgaaacc
tttgacattaacgtcctgcgccgtgagcgcggggtcaaacttgaactggtgaatccaccg
gaagacgcctttgtcgacgggcgaatcatccgttcgctgcaggccaacctgtttgccgtg
ctgcgcgatatcctgttcgttcacgggcagatcgacagcgccggccgtttccagcatctg
aatctggaaaactcggcccacattaccaatctggtgttctctatcctgcgcaacgcccgt
gcgctgcaccttgatgaagatcccaatctggtggtgtgctggggggggcactcgatcaac
gaaaacgaatacctctacgcacgtaaggtcggaagccaactgggcctgcgcgagctgaat
atctgtaccggctgtgggccgggtgccatggaggcaccgatgaaaggcgcggccgtaggc
catgcgcaacagcgctaccacaatagccgctttatcggcatgaccgaaccgtcgatcatc
gccgcagagccacccaacccgttggtcaatgagctggtgatcatgccggacattgaaaag
cgcctggaggccttcgtccgtatcgcccacggcatcatcatcttcccgggcggtgtcggc
acggcagaagagctgctttatctactgggtatcctgatgaacccggagaacagcgaacag
gtgttgccgctgatcctcaccgggccgaaagagagcgccaactacttccaggtgctggat
gagttcatcatgaacacgctgggtgacgaagcgcgccgtcactacaccatcatcatcgac
gatccggccgaagtcgcacgtcagatgaaaaaagccatgccgctggtgaaagagaaccgt
cgtaataccggcgatgcctacagctttaactggtcgatccgcattgcgccggatttgcag
ctgccgtttgagccaagccatgagaatatggccaatctcaacctgtatcccgaccagccg
gccgaacagttggctgccgcgctgcgccgcgcgttttccggcatcgtcgccggtaacgtg
aaggaaaatggcattcatgccatcgaacagtttgggccgtacaagctgcacggcgaaccg
cagatgatgaagcaaatggacagtctgctgcagggctttgtcgctcagcaccggatgaaa
ctgccaggcaccgcttatgtgccctgttacgaaatagtcgcttaa

DBGET integrated database retrieval system