KEGG   Serratia proteamaculans: Spro_4642Help
Entry
Spro_4642         CDS       T00595                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
spe  Serratia proteamaculans
Pathway
spe00564  Glycerophospholipid metabolism
spe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Spro_4642
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Spro_4642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABV43735
UniProt: A8GKU5
LinkDB All DBs
Position
5123795..5125303
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KGLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTKVTRAWRENG
LWMVEAVDVDSGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRVH
DQPQSYILQNEDHRIVFVIPWNDEFSIIGTTDVEYHGDPKDVKIDDNEINYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNGSLPGGDIGGDRDSYAAKLRREHSWLPESLARRFART
YGSHSELILANANSLSDLGEDFGHGLHEAELRYLIDKEWVVELDDAIWRRTKLGMWLDEA
QQARVKAWLAEHVKAKTLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcc
gatgctgccgggcgcgggctgtccgttctgctactggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaactgatccacggcggcctgcgctacctggaacactacgaa
ttccggttggtgagcgaagcgctggccgagcgtgaagtgttactgcgactggcaccacac
atcgccttcccaatgcgtttccgtctgccgcatcagccgcacctgcgcccggcctggatg
atccgtatcggtctgttcctttacgatcacctggggaaacgcaccagtctgccaggcagc
aagggtttgcgctttggaccagaatcggtgctgaagcctgaattgaagcgcggtttcgaa
tattctgactgctgggtcgacgatgctcgcctggtggtactcaatgcccaggaagtggaa
aagcgcggtggcgaagtgcgcacacgcaccaaagtgacccgtgcatggcgtgaaaacggc
ctgtggatggtggaagcggtcgacgtcgacagtggcaaaacctttacctggcgcgccaag
ggcctggtgaacgccaccggtccatgggtgaaacacttcttcgacgatggtctgaagctg
aaatccccttatggcatccgtttgatcaaaggcagccacatcgtggtaccgcgtgtacac
gatcagccacagtcctatattctgcaaaacgaagaccatcgtatcgtcttcgtgatccca
tggaatgacgaattctcgatcatcggcaccaccgacgtggagtatcacggcgatccgaaa
gatgtgaagatcgacgataacgaaatcaactatctgctgaaagtgtataacgaccacttc
aagaagcagttgggccgtgacgatatcgtctggacatactctggcgtgcgtccgctgtgt
gacgacgagtccgattcaccgcaggcggtgacccgtgattacacgctggacgtacatgac
gagcagggtaaagcgccgttgctttccgtattcggcggcaaactgacgacctaccgcaag
ctggctgagcatgcgatggaaaaactggcgcactactaccctggttgtggcccggcgtgg
accaaaaacggttcgctgccaggtggtgacatcggtggcgatcgcgacagctacgccgca
aaactgcgccgtgaacacagctggttgccggaatccctggcacgccgctttgcacgcacc
tacggcagccacagcgagctgatcctggccaatgccaatagcctcagcgacctgggtgaa
gatttcggtcatggcctgcatgaagccgaattgcgctacctgatcgacaaagaatgggtg
gtggaactcgatgacgctatctggcgccgtaccaagctgggtatgtggctggacgaagcg
cagcaggcgcgggtaaaagcctggctggcagaacacgtgaaagcgaaaaccctgtctctg
gcatcgtaa

DBGET integrated database retrieval system