KEGG   Streptococcus periodonticum: EHW89_01870Help
Entry
EHW89_01870       CDS       T06568                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spei  Streptococcus periodonticum
Brite
KEGG Orthology (KO) [BR:spei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EHW89_01870 (ahpF)
Enzymes [BR:spei01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EHW89_01870 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 Thi4 Glutaredoxin FMO-like Ribosomal_L21p NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AZQ41276
LinkDB All DBs
Position
366744..368276
Genome map
AA seq 510 aa AA seqDB search
MALDETIKAQLKQYLELLESDVVFQASLGQDERSEQVRAFLEEIVAMSPRLSLENIETNR
KPSFTVTQVGQAGRVQFAGLPLGHEFTSFVLALLQVSGRAPKVEDAVIKRIQAIKQPLHF
ETYVSLTCHNCPDVVQALNTMAVLNPTISHTMVEGGMFRQEVEDKKIMAVPTVFLNGEEF
ANGRMTIEQLLDKISGPASSEEFDKKEPFDVLVVGGGPAGSSAAIYAARKGIRTGMVVET
FGGQVMETVGIENMIGTPYTEGPKLMAQVEEHAKKYPIDIMKNQRVKNIEKKDLIEVELE
NGAVLKAKTAVLSVGARWRNVNVPGEEEFRTKGVTNCPHCDGPIFTGKKVAVIGGGNSGI
EAAIDLAGLAEHVYVLEFLPTLKADQVLQDRVQQLKNVTVLTNVATKEIHGSDQVEAITY
LDRANNEEHKIELSGVFVQIGLLPNTDWLKNSSVALNERGEIIVDKHGATNVPGIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatgaaacaattaaagcacaactgaagcaatacttggaacttttagaatct
gatgttgtatttcaagcttctttaggtcaagatgagcgttctgagcaggtgcgggctttt
ctagaggaaattgtagcaatgtctccacgtttatcactggaaaatatagagactaaccgc
aagccaagttttaccgttacacaagtggggcaagcagggcgtgtgcagtttgcaggactt
cccttagggcatgaatttacatcttttgtgctggctttgctgcaagtctctggtcgcgca
ccaaaagtagaagatgctgttataaaacgaattcaagctattaagcagccgcttcatttt
gaaacttatgtcagcttaacctgtcataattgtccagacgttgttcaagcactgaataca
atggctgtgctgaatccaactatcagccacacaatggttgaagggggcatgtttagacaa
gaagttgaagacaaaaagatcatggctgtcccaacggtttttctaaatggtgaagaattt
gcaaatggtcgtatgaccattgagcaactgctcgacaagatttctggacctgcttcaagt
gaagaatttgacaaaaaagaaccatttgatgtgttggttgttgggggcggacctgcagga
agcagcgcagctatttatgctgctcgtaagggaattcgtacaggtatggtcgttgaaact
ttcggtggacaagttatggagactgttggtattgaaaatatgattggtactccttataca
gaaggacctaagctgatggcgcaagtagaagaacatgcaaaaaaatatccaattgatatc
atgaagaaccaacgtgttaaaaacatcgagaaaaaggatttgattgaagtggaacttgaa
aatggagctgttctgaaagcgaaaacggcagttctttctgttggtgctcgttggcgaaat
gtcaatgttcctggtgaagaagaattccgaaccaaaggtgtaactaattgtccacattgt
gacggtcctatttttacaggtaaaaaagtggctgttatcggtggaggaaattctggaatt
gaagcagccattgacttagctggtctggcagagcatgtttatgtgttagaatttctacca
actttgaaagccgatcaagtattgcaagacagggtacagcaacttaaaaacgtgacagtt
ctaaccaatgtagctacaaaagaaattcatggttccgatcaagttgaagccattacttat
ctcgatcgtgcaaataatgaagaacataaaattgaactcagcggtgtctttgttcaaatt
ggtcttttgccaaatacagattggcttaagaatagttcagttgctttaaatgagcgtggt
gaaatcattgttgacaaacatggtgcaacaaatgtgccaggaatttttgcagcaggtgat
tgtacagatagtgcttataaacaaatcattatttcaatgggttcaggagcgacggcagct
ttgggagcatttgattatttgattcgtcaataa

DBGET integrated database retrieval system